DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and PHDP

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:237 Identity:70/237 - (29%)
Similarity:96/237 - (40%) Gaps:86/237 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 LSLASSVQ------DTRSPITTLEKSSSSSLNHQRKCSSTPEDFSALYSGLPT-----PGMDSSS 440
            ||:|:.:.      |:...:...|.:...|||         ::.|.|:|.:.|     |...:..
  Fly    33 LSVANHINHYNLMIDSSYKLCANESAIRGSLN---------QESSLLFSKITTVSEFYPATHNIG 88

  Fly   441 HHHTPAHTPPSRLSDHTISAEGAFKKLKPEPNSGLSTVSAGITSPGSGLSSLSQHAGHTPTTASC 505
            .::|..|                   ||...:.|||            |:..|:           
  Fly    89 SYNTDFH-------------------LKSYGDDGLS------------LTDKSK----------- 111

  Fly   506 PTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEK 570
                :||.|||||..||.|||..|.::||||||.|||:|....|.|||:||||||||||:||||:
  Fly   112 ----QRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQER 172

  Fly   571 QL--------------------QKALAPSVIPSCNGMMRNIQ 592
            ..                    .|.|.||:....||..|.::
  Fly   173 HAIYIMKDKSSKLDGRKNPVAGSKYLGPSLKGPQNGHGRQMK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 35/52 (67%)
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.