DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and CG9876

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:289 Identity:87/289 - (30%)
Similarity:120/289 - (41%) Gaps:78/289 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 LNHQRKCSS----TPEDFSALYSGLPTPGMDSSSHHHTPAHTPPSRLSDHTISAEGAFKKLKPEP 471
            ||:|::..|    .|.:|   |.|....|...|||            ..|.:.:|   .||:...
  Fly     2 LNYQQQLHSLPVGNPGNF---YYGPTVSGEIYSSH------------QSHNLESE---DKLEDRE 48

  Fly   472 NSG-------------LSTVSAGITSPGSGLSSLSQHAGHTPTTASC-----PTPAR-------- 510
            .||             :..:.....|.|.....||.:.|  ||.|.|     |.|..        
  Fly    49 ESGRNLDKIHRFSVDNIMEMKHDAYSKGKMAMELSSNFG--PTGAGCGGADRPAPCSGNLPAGGG 111

  Fly   511 ------RRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQE 569
                  ||:||||:..||..||..|.::||||.:.|||||....|:|||:||||||||||:|:.|
  Fly   112 HHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNE 176

  Fly   570 KQL-QKAL---APSVIPSCNGMMRNIQGYSVSRGYQPYPHHNTMNRYPQDLFQMGASSYP-GMTQ 629
            :.: .:.|   ||.::|:  .:..|:..|:    ..|:||       ||.....||.:.. |..:
  Fly   177 RSVGSRTLLDTAPQLVPA--PISNNMHKYA----NMPHPH-------PQPPPPPGAYALNFGPLE 228

  Fly   630 PFSMAHSTN----MGSVGVRQDSMGEFHG 654
            ..|..:.||    .||.|.....:..|.|
  Fly   229 LRSCQNYTNCYGGFGSSGASGSGVCSFFG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 32/52 (62%)
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450857
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.