DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Pph13

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:229 Identity:69/229 - (30%)
Similarity:92/229 - (40%) Gaps:62/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 RRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEK---- 570
            :||:||||...||.|||.||.::||||::.|||||....|.|||:||||||||||:|||||    
  Fly    10 QRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGGL 74

  Fly   571 ----------------------QLQKALA------PSVIPSCNGMMRNIQGYSVSRGYQPYPHHN 607
                                  ||..||.      |...|..:..:.|....|...|..      
  Fly    75 GGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAM------ 133

  Fly   608 TMNRYPQDLF-----------------QMGASSYPGMTQPFSMAHSTNMGSVGVRQDSMGEFHGM 655
            :.:|...::|                 .|..|:||..||  :..| ..|.|....|....:.|..
  Fly   134 SPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQ--AQTH-PQMDSDNQLQQHPPQQHAS 195

  Fly   656 SP---EDEWYNKSLSALRMNSSHHPNLSAPMLQY 686
            .|   ....:::..........|:|.|. |.|::
  Fly   196 DPIHAGSSSHHQQQQQQHQQEQHNPQLH-PGLEF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 34/52 (65%)
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450866
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.