DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and HOXB9

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_076922.1 Gene:HOXB9 / 3219 HGNCID:5120 Length:250 Species:Homo sapiens


Alignment Length:210 Identity:54/210 - (25%)
Similarity:79/210 - (37%) Gaps:62/210 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 CSSTPED--FSALYSGLPTPGMDSS--SHHH---TPAHTPPSRLSDHTISAEGAFKK--LKP--- 469
            ||..|:.  |.|.::.| :|....|  |.:|   .|...||         ||..:.:  |:|   
Human    50 CSFQPKAPVFGASWAPL-SPHASGSLPSVYHPYIQPQGVPP---------AESRYLRTWLEPAPR 104

  Fly   470 ---EPNSGLSTVSAG--ITSPGSGLS------SLSQHAGH------------------------- 498
               .|..|.:.|.|.  :.:||..|.      ||...||.                         
Human   105 GEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKER 169

  Fly   499 ----TPTTASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQ 559
                .|:.......:.|:.|..:|:.|..|||..|..:.|.....|.|:||...|:|.::::|||
Human   170 PDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQ 234

  Fly   560 NRRAKYRKQEKQLQK 574
            |||.|.:|..|:..|
Human   235 NRRMKMKKMNKEQGK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 21/52 (40%)
HOXB9NP_076922.1 Hox9_act 1..172 CDD:282473 28/131 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..182 1/32 (3%)
Homeobox 188..241 CDD:278475 21/52 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.