DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and HOXB5

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens


Alignment Length:285 Identity:73/285 - (25%)
Similarity:104/285 - (36%) Gaps:70/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 LNFSAGGQGGKLSMDELRPNLVGGLLGLQQGLLEDHASMQHGGVGQDTKFMSFQDQRLMGIGGSH 382
            ||:   |.|..||                 |...|.|:|..|..|.:...|.....| .....||
Human    22 LNY---GSGSSLS-----------------GSYRDPAAMHTGSYGYNYNGMDLSVNR-SSASSSH 65

  Fly   383 ENRL----LSLASSVQDTRSPITTLEKSSSSSLNHQRKCS-STPEDFSALYSGLPTPGMDSSSHH 442
            ...:    .:..:..|:.|     ..:::||       || |:||..         |..:..||.
Human    66 FGAVGESSRAFPAPAQEPR-----FRQAASS-------CSLSSPESL---------PCTNGDSHG 109

  Fly   443 HTPAHTPPSRLSDHTISA----------EGAFKKLKPEPNSGLSTVSAGITSPGSGLSSLSQHAG 497
            ..|:.:.|   ||...||          |.:......|..|.||:.|.....|....:|.:...|
Human   110 AKPSASSP---SDQATSASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEG 171

  Fly   498 HTP----------TTASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEA 552
            .||          .:.....|..:|.||.:|:.|..|||..|..:.|.....|.|:|....|:|.
Human   172 QTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSER 236

  Fly   553 RIQVWFQNRRAKYRKQEKQLQKALA 577
            :|::||||||.|::|..|....:||
Human   237 QIKIWFQNRRMKWKKDNKLKSMSLA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 22/52 (42%)
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 26/127 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 27/119 (23%)
Antp-type hexapeptide 176..181 0/4 (0%)
Homeobox 198..251 CDD:395001 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.