DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and HOXA3

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens


Alignment Length:409 Identity:91/409 - (22%)
Similarity:141/409 - (34%) Gaps:116/409 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 LQQGLLEDHASMQHG-------GVGQDTKFMSFQDQRLMGIGGSHENRLLSLASSVQDTRSPITT 402
            :|:....|.:::..|       |...:.....:.....:|..|.:.....||             
Human     1 MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSL------------- 52

  Fly   403 LEKSSSSSLNHQRKCSSTPEDFSALYSGLPTPGMDSSSHHHTPAHTPPSRLSDHTISAEGAFKKL 467
              :|.||:..|.:    ..|...|....|..|.....|....|.|.||.:      :|..|.:..
Human    53 --QSPSSAGGHPK----AHELSEACLRTLSAPPSQPPSLGEPPLHPPPPQ------AAPPAPQPP 105

  Fly   468 KPEPNSGLSTVSAGITSPGSGLSSLSQHAGHTPTTASC--------PTPAR-------------- 510
            :|.|.....|.:|   .|....:|..|:|.:.||.|:.        ||.|:              
Human   106 QPAPQPPAPTPAA---PPPPSSASPPQNASNNPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTK 167

  Fly   511 ------------------------RRHRTTFTQEQLAELEAAFAKSHYPDIYCRE---ELARTTK 548
                                    :|.||.:|..||.|||..|   |:....||.   |:|....
Human   168 QKTSSSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEF---HFNRYLCRPRRVEMANLLN 229

  Fly   549 LNEARIQVWFQNRRAKYRKQEKQLQKAL-------APS---VIPSCNGMMRNIQGYSVSRGYQPY 603
            |.|.:|::||||||.||:|.:|  .|.:       :||   |.|...|.:.::.....|..|:|.
Human   230 LTERQIKIWFQNRRMKYKKDQK--GKGMLTSSGGQSPSRSPVPPGAGGYLNSMHSLVNSVPYEPQ 292

  Fly   604 --PHHNTMNRYPQDLFQMGASSYPGMTQPFSMAHSTNMGSVGVRQDSMGEFHGMSPEDEWYNKSL 666
              |   ..::.||..:.:..:|||.     |:...........|..:.|...|.:|:   |:...
Human   293 SPP---PFSKPPQGTYGLPPASYPA-----SLPSCAPPPPPQKRYTAAGAGAGGTPD---YDPHA 346

  Fly   667 SALRMNSSHHPNLSAPMLQ 685
            ..|:.|.|:    ..|.:|
Human   347 HGLQGNGSY----GTPHIQ 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 24/55 (44%)
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 20/80 (25%)
Antp-type hexapeptide 155..160 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 1/36 (3%)
Homeobox 195..248 CDD:395001 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 20/100 (20%)
DUF4074 378..441 CDD:404218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.