DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and HOXA1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_005513.2 Gene:HOXA1 / 3198 HGNCID:5099 Length:335 Species:Homo sapiens


Alignment Length:295 Identity:78/295 - (26%)
Similarity:119/295 - (40%) Gaps:45/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 LVGGLLGLQQGLLEDHASMQHGGVGQDTKFMSFQDQRLMGIGGSHENRLLSLASSVQDTRSPITT 402
            |||  .|:|.|....|....|    :..:..::|....:|:..||.:...|..|  |:..:|.  
Human    54 LVG--RGVQIGSPHHHHHHHH----RHPQPATYQTSGNLGVSYSHSSCGPSYGS--QNFSAPY-- 108

  Fly   403 LEKSSSSSLNHQRKCS-STPEDFSALYSGLPTPGMDSSSHHH---------TPAHTPPSRLSDHT 457
                |..:||.:...| ..|:...|:|||..:..|....|||         :|.:...|...:|.
Human   109 ----SPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQ 169

  Fly   458 ISAEGAFKKLKPEPNSGLSTVSA----GITSPGSGLSSLSQHAGHTPTTASCPTPAR-------- 510
            ..|...:       |:.||.:.|    ...||.|..||.:|.........:.|...:        
Human   170 SLALATY-------NNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLG 227

  Fly   511 --RRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQ 573
              ...||.||.:||.|||..|..:.|.....|.|:|.:.:|||.::::||||||.|.:|:||:..
Human   228 QPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGL 292

  Fly   574 KALAPSVIPSCNGMMRNIQGYSVSRGYQPYPHHNT 608
            ..::|:..|..:.........|.|....|.|..:|
Human   293 LPISPATPPGNDEKAEESSEKSSSSPCVPSPGSST 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 24/52 (46%)
HOXA1NP_005513.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..83 4/25 (16%)
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 75..203 34/142 (24%)
COG5576 176..>286 CDD:227863 35/116 (30%)
Antp-type hexapeptide 204..209 0/4 (0%)
Homeobox 233..286 CDD:365835 24/52 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..335 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.