DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and CG11294

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:177 Identity:60/177 - (33%)
Similarity:91/177 - (51%) Gaps:27/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 RRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEK-QL- 572
            :||:|||||.:||.||||.|.|:||||::.|||:|....|:|||:||||||||||:|||.: || 
  Fly    24 QRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQNRRAKWRKQARLQLL 88

  Fly   573 -----QKALAPSVIPSCNGMMRNIQGYS----VSRGYQPYPHHNTMNRYPQDLFQMG----ASSY 624
                 .:.|:....|...|  ..:||.|    .:|.....|.:.:......:|.::|    :.|:
  Fly    89 QDAWRMRCLSLGTPPVMGG--GAVQGGSGNGATARPPSQTPENLSSASKDSELAEVGNGPNSGSF 151

  Fly   625 PGMTQPFSMAHSTNMGSVGVRQDSMGEFHGMSPEDEWYNKSLSALRM 671
            ..|...|...|          |....:.|..:.:.:..:|:.:.|::
  Fly   152 TMMHPAFQQQH----------QQQQHQGHQQATDQDKLSKTYTELKL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 35/52 (67%)
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 34/50 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450868
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.