DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and arxa

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_571459.1 Gene:arxa / 30657 ZFINID:ZDB-GENE-990415-15 Length:453 Species:Danio rerio


Alignment Length:326 Identity:90/326 - (27%)
Similarity:134/326 - (41%) Gaps:96/326 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 QRLMGIGGS--------HEN-------RLLSLA-SSVQDTRSPITTLEKSSSSSLNHQRKCSSTP 421
            :||.|.||.        ||:       |||..| .|::.:::|..::.:|.|...|         
Zfish    80 RRLYGPGGKYLDSGRGFHEHLEKGERERLLDQACESLKISQAPQVSISRSKSYREN--------- 135

  Fly   422 EDFSALYSGLPTPGMDSSSHHHTPAHTPPSRLSDHTISAEGAFKK--------LKPEPNSGLST- 477
                |.:|        .|....:|.|.....:...|:..|....|        |.|:....|.. 
Zfish   136 ----APFS--------QSDEGQSPEHMAQELVELSTLKFEEDVVKEEACGDNSLSPKDEESLHND 188

  Fly   478 -----------VSAGITSPGSGLSSLSQHAGHTPTTASCPTPARRRHRTTFTQEQLAELEAAFAK 531
                       :|||..|. .|:....|                ||:|||||..||.|||.||.|
Zfish   189 GDVKDGEDSVCLSAGSDSE-EGMLKRKQ----------------RRYRTTFTSYQLEELERAFQK 236

  Fly   532 SHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQKALA-----PSVIPSCNGMMRNI 591
            :||||::.|||||....|.|||:||||||||||:||:||...:|..     |..:.:.:.:...:
Zfish   237 THYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGVQAHPTGLPFPGPLAAAHPLSHYL 301

  Fly   592 QGYSVSRGYQPYPHHNTMNRYPQDLFQMGASSYPGMTQP---FSMAHSTNMGSVGVRQDSMGEFH 653
            :|    ..:.|:||....:.:  ......|:::||:..|   .::..:|.:|        :|.|.
Zfish   302 EG----GPFPPHPHPALESAW--TAAAAAAAAFPGLAPPPNSSALPPATPLG--------LGTFL 352

  Fly   654 G 654
            |
Zfish   353 G 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 36/52 (69%)
arxaNP_571459.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..149 7/45 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..212 8/42 (19%)
Homeobox 219..271 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..418
OAR 417..434 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 421..434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.