DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and msx1b

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_571335.1 Gene:msx1b / 30511 ZFINID:ZDB-GENE-980526-26 Length:257 Species:Danio rerio


Alignment Length:279 Identity:69/279 - (24%)
Similarity:103/279 - (36%) Gaps:78/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 RSPI--TTLEKSSSSSLNHQRKCSSTPEDFSALYSGLPTPGMDSSSHHHTPAHTPPSRLSDHTIS 459
            :.|:  |:.|||.|.|...|:     |.|.:|           .:.|.....:.|   .|..::.
Zfish     5 KGPVETTSQEKSESDSEESQK-----PRDMTA-----------DTGHKAKKTYLP---FSVESLM 50

  Fly   460 AEGAFKKLKPEPN-------------------------SGLSTVSAGITSPGSGLSSLSQHAGH- 498
            |:.:.:::...|.                         ..||:||..:......||...|.... 
Zfish    51 AKSSCQQVACSPALQHQRMGHGQDLVRTYFVEKAKVSVDTLSSVSDSLNDDSEELSDKEQSTWSN 115

  Fly   499 -----TPTTASCPTP-------ARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNE 551
                 :|.....|||       ..|:.||.|:..||..||..|.:..|..|..|.|.:.:..|.|
Zfish   116 SSSFTSPPRHPSPTPCTLRKHKTNRKPRTPFSTSQLLSLERKFRQKQYLSIAERAEFSNSLNLTE 180

  Fly   552 ARIQVWFQNRRAKYRK-QEKQLQK-------ALAPSVIPSCNGMMRNIQGYSVSRGYQPYPHHNT 608
            .::::||||||||.:: ||.:|:|       .|||..:|...|...::.|...|.. :|.|....
Zfish   181 TQVKIWFQNRRAKAKRLQEAELEKFKCASKPLLAPFALPFPLGSPSSLYGPPASFP-RPVPMPGL 244

  Fly   609 MNRYPQDLFQMGASSYPGM 627
            .|         |..|| ||
Zfish   245 FN---------GPVSY-GM 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 22/52 (42%)
msx1bNP_571335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37 12/47 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..146 14/54 (26%)
Homeobox 142..195 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.