DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and hoxd9a

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_571201.3 Gene:hoxd9a / 30350 ZFINID:ZDB-GENE-990415-121 Length:262 Species:Danio rerio


Alignment Length:258 Identity:64/258 - (24%)
Similarity:97/258 - (37%) Gaps:65/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 SFQDQRLMGIGGSHENRLLSLASSVQDTRS----PITTLEKSSSSSLNHQRKCSSTPEDFSALY- 428
            |:....:||    ||...:..|..:|.:.:    |...:|.:..||.:...|.:..|..:|::: 
Zfish     9 SYYVDTIMG----HEAEDVYGARYIQGSHTAPARPSGVVENADFSSCSFAPKSAVFPASWSSVHQ 69

  Fly   429 ------SGLPTP---------------------------GMDSSSHHH-TPAHT-PPSRLSDHTI 458
                  ||:..|                           |...:|.|. |...: ||.|    |.
Zfish    70 PSTAAVSGIYHPYVHQTHLSDNRYVRSWIEPVANHISLTGFHPNSRHSGTKTESLPPKR----TE 130

  Fly   459 SAEGAFKKLKPE-PNSGLSTVSAGITSP-----GSGLSSLSQHAGHTPTTASCPT-PA------- 509
            ||  ||:...|. |...|:.||......     ||..||..:...........|: ||       
Zfish   131 SA--AFETETPSVPEFSLNAVSESADKATEERVGSDNSSHGEPKDEKQQQQLDPSNPAANWIHAR 193

  Fly   510 -RRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQ 571
             .|:.|..:|:.|..|||..|..:.|.....|.|:||...|.|.::::||||||.|.:|..::
Zfish   194 STRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNRE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 21/52 (40%)
hoxd9aNP_571201.3 Hox9_act 1..182 CDD:282473 38/182 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..187 23/85 (27%)
Homeobox 198..251 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.