Sequence 1: | NP_608318.5 | Gene: | CG32532 / 32943 | FlyBaseID: | FBgn0052532 | Length: | 688 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571201.3 | Gene: | hoxd9a / 30350 | ZFINID: | ZDB-GENE-990415-121 | Length: | 262 | Species: | Danio rerio |
Alignment Length: | 258 | Identity: | 64/258 - (24%) |
---|---|---|---|
Similarity: | 97/258 - (37%) | Gaps: | 65/258 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 369 SFQDQRLMGIGGSHENRLLSLASSVQDTRS----PITTLEKSSSSSLNHQRKCSSTPEDFSALY- 428
Fly 429 ------SGLPTP---------------------------GMDSSSHHH-TPAHT-PPSRLSDHTI 458
Fly 459 SAEGAFKKLKPE-PNSGLSTVSAGITSP-----GSGLSSLSQHAGHTPTTASCPT-PA------- 509
Fly 510 -RRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQ 571 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32532 | NP_608318.5 | Homeobox | 513..566 | CDD:278475 | 21/52 (40%) |
hoxd9a | NP_571201.3 | Hox9_act | 1..182 | CDD:282473 | 38/182 (21%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 107..187 | 23/85 (27%) | |||
Homeobox | 198..251 | CDD:278475 | 21/52 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |