DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Dlx4

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001100510.1 Gene:Dlx4 / 303469 RGDID:1308744 Length:238 Species:Rattus norvegicus


Alignment Length:265 Identity:68/265 - (25%)
Similarity:98/265 - (36%) Gaps:76/265 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 LMGIGGSHENRL---LSLASSV----QDTRSPITTLEKSSSSSLNHQRKCSSTPEDFSALYSGLP 432
            |.|:|.|  |.:   |:.||||    |...||.|......|.|..:....|.:       |.|..
  Rat     8 LPGLGPS--NVVFPDLAPASSVVAAYQLGLSPGTAASPDLSFSQTYGHLLSYS-------YPGPA 63

  Fly   433 TPG------MDSSSHHHTPAHTPPSRLSDHTISAEGAFKKLKPEPNSGLSTVSAGITSPGSGLSS 491
            |||      ...|:....|.|.|    ::|....|...:||                       :
  Rat    64 TPGDSYLSSQQQSAAPSRPFHQP----TEHPQELEAESEKL-----------------------A 101

  Fly   492 LSQHAGHTPTTASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQV 556
            ||..    |:..|. |...|:.||.::..||..|...|..:.|..:..|.:||....|.:.::::
  Rat   102 LSLE----PSQPSL-TRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKI 161

  Fly   557 WFQNRRAKYRKQEKQLQKAL-----------------APSV--IPSCNGMMRNIQGYSVSRGYQP 602
            ||||:|:||:|..||....|                 .||:  :|....:..:  ||..|.|.. 
  Rat   162 WFQNKRSKYKKLLKQSSGELEEDFSGRPPSLSPHSLTLPSIWDLPKAGTLPTS--GYDNSFGTW- 223

  Fly   603 YPHHN 607
            |.||:
  Rat   224 YQHHS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 17/52 (33%)
Dlx4NP_001100510.1 Homeobox 118..172 CDD:395001 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.