DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and hoxb9a

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_571196.2 Gene:hoxb9a / 30344 ZFINID:ZDB-GENE-990415-109 Length:249 Species:Danio rerio


Alignment Length:231 Identity:57/231 - (24%)
Similarity:85/231 - (36%) Gaps:24/231 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 HASMQHGGVGQDTKFMSFQDQRLMGIGGSHENRLLSLAS----SVQDTRSPITTLEKSSSSSLNH 413
            ::|.:..|.|:..:|.|...|....:..|..:...|.||    :|.....|...:..:.:..|..
Zfish    33 YSSARQPGPGEHPEFPSCSFQPKPPVFSSSWSPFSSHASNGLPAVYHPYIPTQPVPSTDTRYLRT 97

  Fly   414 QRKCSSTPEDFSALYSGLPTPGMDSSSHHHTPAH--TPPSRLSDHTISAEGAFKKLKPEPNSGLS 476
            ...|:...|         |.||...........|  .||..:..|....|.:..:   |.|||  
Zfish    98 WLDCAPRAE---------PLPGQGQVKMEPLLGHLGEPPKLVGQHEYILESSTAR---EINSG-- 148

  Fly   477 TVSAGITSPGSGLSSLSQHAG---HTPTTASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIY 538
             .|||...............|   :.|:.......:.|:.|..:|:.|..|||..|..:.|....
Zfish   149 -HSAGFEDNKDICEGSEDKEGPDQNDPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRD 212

  Fly   539 CREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQK 574
            .|.|:||...|.|.::::||||||.|.:|..|...|
Zfish   213 RRHEVARLLNLTERQVKIWFQNRRMKMKKMNKDQPK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 21/52 (40%)
hoxb9aNP_571196.2 Hox9_act 1..171 CDD:282473 31/152 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..182 8/38 (21%)
Homeobox 187..240 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.