DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Mixl1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001099449.1 Gene:Mixl1 / 289311 RGDID:1310011 Length:231 Species:Rattus norvegicus


Alignment Length:142 Identity:56/142 - (39%)
Similarity:69/142 - (48%) Gaps:36/142 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 SGLPTPGMDSSSHHHTPAHTP--PSRLSDHTISAEGAFKKLKPEPNSGLSTVSAGITSPGSGLSS 491
            :|||....||    ..||.||  |||               .|.|.:...|   |:..||....|
  Rat    37 TGLPPAPPDS----RAPAATPCFPSR---------------GPRPAAQTPT---GLDPPGPSKGS 79

  Fly   492 LSQHAGHTPTTASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQV 556
                        :.|:..:||.||:|:.|||..||..|.::.||||:.||.||..|.|.|:||||
  Rat    80 ------------AAPSAPQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQV 132

  Fly   557 WFQNRRAKYRKQ 568
            ||||||||.|:|
  Rat   133 WFQNRRAKSRRQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 32/52 (62%)
Mixl1NP_001099449.1 PRK14971 <2..139 CDD:237874 51/135 (38%)
Homeobox 89..143 CDD:395001 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.