DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Prop1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_705891.1 Gene:Prop1 / 266738 RGDID:628759 Length:223 Species:Rattus norvegicus


Alignment Length:233 Identity:73/233 - (31%)
Similarity:102/233 - (43%) Gaps:68/233 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 PEPNSG----LSTV------SAGITSPGSGLSSLSQHAGHTPTTASCPTPARRRHRTTFTQEQLA 523
            ||..:.    :|||      |..::..|.|...|....|.        ..:||||||||...||.
  Rat    23 PESQAASGTLISTVDRSPETSKRLSGTGLGRPKLCPQRGR--------PHSRRRHRTTFNPAQLG 79

  Fly   524 ELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQKALAPSVIPSCNGMM 588
            :||:||.::.||||:.||.||:.|.|:||||||||||||||.||||:.|.:..|.....:.:|.:
  Rat    80 QLESAFGRNQYPDIWVREGLAQDTGLSEARIQVWFQNRRAKQRKQERSLLQPTAHLSPATFSGFL 144

  Fly   589 RNIQGYSVSRGYQ---------PYPHHNTMNRYPQDLFQMGASSYPGMTQPFSMAHSTNMGSVGV 644
            .....|..:  |.         |:|:::.:...|    ..|||    :|.|              
  Rat   145 SESSPYPYT--YTTPPPPVPCFPHPYNHALPSQP----CTGAS----LTLP-------------- 185

  Fly   645 RQDSMGEFHGMSPEDEWYNKSLSALRMNSSHHPNLSAP 682
                      ..||| ||.      .::.:|..:|:.|
  Rat   186 ----------AQPED-WYP------TLHPTHTGHLACP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 35/52 (67%)
Prop1NP_705891.1 Homeobox 69..123 CDD:395001 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5351
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.