DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Tlx2

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_033418.1 Gene:Tlx2 / 21909 MGIID:1350935 Length:284 Species:Mus musculus


Alignment Length:150 Identity:49/150 - (32%)
Similarity:71/150 - (47%) Gaps:30/150 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 HTPAHTPPSRLSDHTISAEGAFKKLKPEPNSGLSTVS--AGITSP--GSG-----------LSSL 492
            |.|...||         ..||...: |.| |||....  ||:|.|  .||           ||..
Mouse    86 HRPLPVPP---------PSGAAPAV-PGP-SGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPF 139

  Fly   493 S--QHAGHTPTTASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQ 555
            |  :..|| |.....| |.|::.||:|::.|:.|||..|.:..|.....|..||:..::.:|:::
Mouse   140 SGTRRIGH-PYQNRTP-PKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVK 202

  Fly   556 VWFQNRRAKYRKQEKQLQKA 575
            .||||||.|:|:|..:.::|
Mouse   203 TWFQNRRTKWRRQTAEEREA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 20/52 (38%)
Tlx2NP_033418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..52
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..104 7/27 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..166 10/27 (37%)
Homeobox 160..213 CDD:306543 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.