DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Rhox11

DIOPT Version :10

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_941000.1 Gene:Rhox11 / 194738 MGIID:2681831 Length:206 Species:Mus musculus


Alignment Length:137 Identity:40/137 - (29%)
Similarity:65/137 - (47%) Gaps:25/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 KPEPNSGLSTVSAGITSPGSGL------SSLSQHAGHTPTTASC----PTPARRRHRTT------ 516
            :||.....::.|.|.....:|:      ||:.:|:...|.|...    |....:...|:      
Mouse    25 EPEEKVAYTSNSGGFADEVTGIPKEGHQSSIGEHSCVMPNTQDTGREEPEETSKVAETSEQSLFR 89

  Fly   517 -------FTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQL-- 572
                   ||..||.||:|.|.::.|||...|:|||....::|.:|:.||.|:||||||.::::  
Mouse    90 IPRKAYRFTPGQLWELQAVFVENQYPDALKRKELAGLLNVDEQKIKDWFNNKRAKYRKIQREILG 154

  Fly   573 QKALAPS 579
            .|.:.|:
Mouse   155 GKNITPT 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeodomain 511..567 CDD:459649 25/68 (37%)
Rhox11NP_941000.1 Homeodomain 96..147 CDD:459649 24/50 (48%)

Return to query results.
Submit another query.