DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Pitx1

DIOPT Version :10

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_035227.1 Gene:Pitx1 / 18740 MGIID:107374 Length:315 Species:Mus musculus


Alignment Length:107 Identity:24/107 - (22%)
Similarity:34/107 - (31%) Gaps:29/107 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GRARRMCKSKKNTHLDSLLGCLSVLMKNSELQLDSLDIIVYHNH------------------NTI 115
            |..|....:..|.|:.:.........|...||:...|.:...|:                  |.|
Mouse   443 GLVRAAQSTAMNRHIKATTQVEVDTEKAQTLQVSRSDFLASLNNDIKPAFGSNQEDYSSYIMNGI 507

  Fly   116 VKWF----------EELV-QSKNQTHCKHVQLVAPGVQHSSE 146
            |||.          |.|| |:||......|.::..|..||.:
Mouse   508 VKWSNAVSDILGDGELLVQQTKNSERTPLVTVLLEGPAHSGK 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeodomain 511..567 CDD:459649
Pitx1NP_035227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104
Homeodomain 91..147 CDD:459649
Interaction with PIT-1 151..280
OAR 277..294 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 281..294
Nuclear localization signal. /evidence=ECO:0000255 287..291
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.