DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and npax-4

DIOPT Version :10

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001255346.1 Gene:npax-4 / 182466 WormBaseID:WBGene00007496 Length:202 Species:Caenorhabditis elegans


Alignment Length:52 Identity:14/52 - (26%)
Similarity:24/52 - (46%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 SFQDQRLMGIGGSHENRLLSLASSVQDTRSPITTLEKSSSSSLNHQRKCSST 420
            ||..|:.:..|....:.|.:|....:..|.|...:||.:||.::.|:....|
 Worm    22 SFAAQKALSNGHPSGSSLAALEKLSKAFRRPDLHIEKLASSCIDKQKDLKMT 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeodomain 511..567 CDD:459649
npax-4NP_001255346.1 HTH_ARSR 79..>142 CDD:481197
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.