DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and DLX4

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_612138.1 Gene:DLX4 / 1748 HGNCID:2917 Length:240 Species:Homo sapiens


Alignment Length:243 Identity:59/243 - (24%)
Similarity:95/243 - (39%) Gaps:59/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 SLASSVQDTRSPITTLEKSSSSSLNHQRKCSSTPEDFSALYSGLPTPGMDSSSHHHTPA--HTPP 450
            |:|::.....||.|    ::|.:|::.|.....   .|..|:....|| ||......||  ..|.
Human    26 SVAAAYPLGLSPTT----AASPNLSYSRPYGHL---LSYPYTEPANPG-DSYLSCQQPAALSQPL 82

  Fly   451 SRLSDH--TISAEGAFKKLKPEPNSGLSTVSAGITSPGSGLSSLSQHAGHTPTTASCPTPARRRH 513
            ...::|  .:.|:....:|.|||:.                           .....|....|:.
Human    83 CGPAEHPQELEADSEKPRLSPEPSE---------------------------RRPQAPAKKLRKP 120

  Fly   514 RTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQL---QKA 575
            ||.::..||..|...|..:.|..:..|.:||....|.:.::::||||:|:||:|..||.   |:.
Human   121 RTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEG 185

  Fly   576 LAP----SVIPSCNGMMRNI-----------QGYSVSRGYQPYPHHNT 608
            ..|    ||.| |:..:.::           .||..|.|.. |.||::
Human   186 DFPGRTFSVSP-CSPPLPSLWDLPKAGTLPTSGYGNSFGAW-YQHHSS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 17/52 (33%)
DLX4NP_612138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..120 9/66 (14%)
Homeobox 120..173 CDD:306543 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.