DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Hoxb9

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus


Alignment Length:148 Identity:40/148 - (27%)
Similarity:64/148 - (43%) Gaps:27/148 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 LYSGLPTPGMDSSSHHHTPAHTPPSRLSDHTISAEGAFKKLKPEPNSGLSTVSAGITSPGSGLSS 491
            |..|.|...:::|:..........:...|:.| .||:..|.:|:.           |:|    |:
Mouse   129 LKQGTPEYSLETSAGREAVLSNQRAGYGDNKI-CEGSEDKERPDQ-----------TNP----SA 177

  Fly   492 LSQHAGHTPTTASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQV 556
            ...||           .:.|:.|..:|:.|..|||..|..:.|.....|.|:||...|:|.::::
Mouse   178 NWLHA-----------RSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKI 231

  Fly   557 WFQNRRAKYRKQEKQLQK 574
            ||||||.|.:|..|:..|
Mouse   232 WFQNRRMKMKKMNKEQGK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 21/52 (40%)
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:398350 10/43 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 8/37 (22%)
Homeobox 188..242 CDD:395001 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.