DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Esx1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_031983.2 Gene:Esx1 / 13984 MGIID:1096388 Length:382 Species:Mus musculus


Alignment Length:103 Identity:42/103 - (40%)
Similarity:54/103 - (52%) Gaps:18/103 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 PARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEK-- 570
            |..||:|..||..||.||||.|.:..|||::.|.||||...|.|.|:||||||||||:|:..:  
Mouse   184 PKPRRYRICFTPIQLQELEAFFQRVQYPDLFARVELARRLGLPEPRVQVWFQNRRAKWRRLRRAQ 248

  Fly   571 ----QLQKALAPSVIPSCNGMMRNIQGYSVSRGYQPYP 604
                .:..|::|.|            |..:...|.|.|
Mouse   249 AFRNMVPVAMSPPV------------GVYLDDHYGPIP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 31/52 (60%)
Esx1NP_031983.2 Homeobox 190..237 CDD:278475 26/46 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.