DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Crx

DIOPT Version :10

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001106801.1 Gene:Crx / 12951 MGIID:1194883 Length:323 Species:Mus musculus


Alignment Length:94 Identity:21/94 - (22%)
Similarity:33/94 - (35%) Gaps:27/94 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DNLLNQLESCKICILRGVCKKLKNFIDNKDPGFKIVKITVHQNSSDMFMDREGGYTFVNDLPHGI 67
            |.|||.|||.::.:.......:.||              .|:           |...:.|....:
Mouse   169 DKLLNCLESLRVSLTSNPVSWVNNF--------------GHE-----------GLGLLLDALERL 208

  Fly    68 VGRARRMCKSKKNTHLDSLLGCLSVLMKN 96
            :.:.::....|||.|  .|:.||...|.|
Mouse   209 LDKKQQENIDKKNQH--KLIQCLKAFMNN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeodomain 511..567 CDD:459649
CrxNP_001106801.1 Homeodomain 64..117 CDD:459649
TF_Otx 188..273 CDD:427350 14/75 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.