DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Prrxl1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_006518472.1 Gene:Prrxl1 / 107751 MGIID:2148204 Length:354 Species:Mus musculus


Alignment Length:291 Identity:82/291 - (28%)
Similarity:111/291 - (38%) Gaps:81/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 PPSRLSDHTISA---EGA---FKKLKPEPNSGLSTVSAGITSPGSGLSSLSQHAGHTPTTASCPT 507
            ||..:....::|   .||   .|..:|.|         .:..|...:...:....|.|.......
Mouse    50 PPKPIRRRQLAALCQAGATHRHKSARPLP---------ALVQPSGPIRPSAMFYFHCPPQLEGTA 105

  Fly   508 P----------------ARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQV 556
            |                .:||:|||||.:||..|||.||::||||::.|||||....|.|||:||
Mouse   106 PFGNHSTGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQV 170

  Fly   557 WFQNRRAKYRK-------QEKQLQKALAPSVIPSCNGMMRNIQGYSVSRGYQPYPHHNTMNRYPQ 614
            ||||||||:||       ||...::.:|....|.    :|||.        .|.|...|.::...
Mouse   171 WFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPP----VRNIN--------SPPPGDQTRSKKEA 223

  Fly   615 DLFQMGASSYPGMTQPF--SMAHSTNMGSVGVRQ-------------------DSMG----EFHG 654
            ...|.......|.|.||  |....|.:.:....|                   |.||    ..:|
Mouse   224 LEAQQSLGRTVGPTGPFFPSCLPGTLLNTATYAQALSHVASLKGGPLCSCCVPDPMGLSFLPTYG 288

  Fly   655 MSPEDEWYNKSLSALRMNSSHHPNLSAPMLQ 685
            ....   ...|::||||.:..|   |..:||
Mouse   289 CQSN---RTASVAALRMKAREH---SEAVLQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 35/52 (67%)
Prrxl1XP_006518472.1 Homeobox 128..181 CDD:365835 35/52 (67%)
OAR 292..309 CDD:367680 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.