DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Hoxa1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_037207.2 Gene:Hoxa1 / 103690132 RGDID:11414885 Length:334 Species:Rattus norvegicus


Alignment Length:264 Identity:67/264 - (25%)
Similarity:104/264 - (39%) Gaps:39/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 SFQDQRLMGIGGSHENRLLSLASSVQDTRSPITTLEKSSSSSLNHQRKCS-STPEDFSALYSGLP 432
            ::|....:|:..||.:  ...:...|:..:|.      ....||.:...| ..|....|:|||..
  Rat    78 TYQTSGNLGVSYSHSS--CGPSYGAQNFSAPY------GPYGLNQEADVSGGYPPCAPAVYSGNL 134

  Fly   433 TPGMDSSSHHH---------TPAHTPPSRLSDHTISAEGAFKKLKPEPNSGLSTVSA----GITS 484
            :..|....|||         :|.:...|...:|...|...:       |:.||.:.|    ...|
  Rat   135 SSPMVQHHHHHQGYAGGTVGSPQYIHHSYGQEHQSLALATY-------NNSLSPLHASHQEACRS 192

  Fly   485 PGSGLSSLSQHAGHTPTTASCPTPAR----------RRHRTTFTQEQLAELEAAFAKSHYPDIYC 539
            |.|..||.:|.........:.|...:          ...||.||.:||.|||..|..:.|.....
  Rat   193 PASETSSPAQTFDWMKVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQLTELEKEFHFNKYLTRAR 257

  Fly   540 REELARTTKLNEARIQVWFQNRRAKYRKQEKQLQKALAPSVIPSCNGMMRNIQGYSVSRGYQPYP 604
            |.|:|.:.:|||.::::||||||.|.:|:||:....::|:..|..:.........|.|....|.|
  Rat   258 RVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSSSPSAPSP 322

  Fly   605 HHNT 608
            ..:|
  Rat   323 ASST 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 24/52 (46%)
Hoxa1NP_037207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..82 1/3 (33%)
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 74..202 31/138 (22%)
COG5576 175..>285 CDD:227863 35/116 (30%)
Antp-type hexapeptide 203..208 0/4 (0%)
Homeobox 232..284 CDD:278475 24/51 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..334 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.