DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and ZNF541

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:XP_011525670.1 Gene:ZNF541 / 84215 HGNCID:25294 Length:1351 Species:Homo sapiens


Alignment Length:237 Identity:65/237 - (27%)
Similarity:95/237 - (40%) Gaps:41/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 EEKIRVGRDYQAVCPPLVPEAERRPEQMNER-ALLVWSP------TKEIPDLKLEEYISVAKEKY 146
            |..|.:|..:||..|.|   .||.....:|. |.|||.|      :.|..| ::.|..:||....
Human  1057 EPHINIGSRFQAEIPEL---QERSLAGTDEHVASLVWKPWGDMMISSETQD-RVTELCNVACSSV 1117

  Fly   147 ----GYNGEQALGMLFWHKHDLERAVMDLANFTPF--------------PDEWTIEDKVLFEQAF 193
                |.|.|.||..|...:.:::.|:..|....|.              .|.||..:|.||::||
Human  1118 MPGGGTNLELALHCLHEAQGNVQVALETLLLRGPHKPRTHLLADYRYTGSDVWTPIEKRLFKKAF 1182

  Fly   194 QFHGKSFHRIRQMLPDKSIASLVKYYYSWKK-TRHRSSAMDRQEKAIKAVVKDGSENGSEVGSNE 257
            ..|.|.|:.|.:|:..|::|..|:|||.||| .:.........||.:|       ....||...|
Human  1183 YAHKKDFYLIHKMIQTKTVAQCVEYYYIWKKMIKFDCGRAPGLEKRVK-------REPEEVERTE 1240

  Fly   258 ES---DNDDKKGHGTNSTINTIDATTTSTNNSTTNSNT-TTP 295
            |.   ...::..|.....:.|......|..:|:.|:.: .||
Human  1241 EKVPCSPRERPSHHPTPKLKTKSYRRESILSSSPNAGSKRTP 1282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 19/58 (33%)
SANT 179..225 CDD:197842 22/46 (48%)
SANT 180..224 CDD:304392 19/43 (44%)
SANT 540..582 CDD:238096
ZNF541XP_011525670.1 C2H2 Zn finger 142..162 CDD:275368
zf-C2H2 142..162 CDD:278523
COG5048 150..>324 CDD:227381
zf-H2C2_2 154..179 CDD:290200
C2H2 Zn finger 170..195 CDD:275368
C2H2 Zn finger 203..225 CDD:275368
ELM2 1060..1115 CDD:279754 19/58 (33%)
SANT 1170..1214 CDD:197842 20/43 (47%)
SANT 1170..1213 CDD:304392 19/42 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.