DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and MIER1

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:NP_001337459.1 Gene:MIER1 / 57708 HGNCID:29657 Length:602 Species:Homo sapiens


Alignment Length:428 Identity:95/428 - (22%)
Similarity:146/428 - (34%) Gaps:125/428 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NNSGHSGNANANEKTTTAVPGAGTPESSDDDNSTK------------RNGKSKAKQSEYEEKIRV 94
            :|||.||. |..|....:.......:||:||.|..            |..|.....||.||:...
Human   195 DNSGCSGE-NKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEE 258

  Fly    95 GRDYQAVCPPLVPEAERRPEQM------------------NERAL-----LVWSPTKEIPDLKLE 136
            ..||       :|..:.:.|.|                  ||:..     |:|.| :.:|:.|:.
Human   259 DEDY-------IPSEDWKKEIMVGSMFQAEIPVGICRYKENEKVYENDDQLLWDP-EYLPEDKVI 315

  Fly   137 EYISVAKEKYG--------------YNGEQALGMLFWHKHDLERAVMDLA-NFTPFPDE---WTI 183
            .::..|..:.|              .:.||||..|.....|.|.|:..|. |.....:|   ||.
Human   316 IFLKDASRRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRFNVKAAREELSVWTE 380

  Fly   184 EDKVLFEQAFQFHGKSFHRIR-QMLPDKSIASLVKYYYSWKK----------------------- 224
            |:...|||..:.:||.||.|: ..:..:|:...|.:||.|||                       
Human   381 EECRNFEQGLKAYGKDFHLIQANKVRTRSVGECVAFYYMWKKSERYDFFAQQTRFGKKKYNLHPG 445

  Fly   225 -TRHRSSAMDRQEKAIKAVVKDGSENGSEVGSNEESDNDDKKGHGTNSTINTIDATTTSTNNSTT 288
             |.:....:|..|.|..:.........|. .||.:|:.:|    ||.||.|        .|..::
Human   446 VTDYMDRLLDESESAASSRAPSPPPTASN-SSNSQSEKED----GTVSTAN--------QNGVSS 497

  Fly   289 NSNTTTPANIIAN---TINSNHSSSNSGGG-----GNINNNGEENIQAVGGSNTISNTSNNDMDA 345
            |.    |..|:..   .:...|.:..:||.     .:::.||.|.............|:.|:.|.
Human   498 NG----PGEILNKEEVKVEGLHINGPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDF 558

  Fly   346 EQLSLFAGNAQIEEMMALGLAADRAIGANGGNNNNNGE 383
            ::.|        |..     |..|.:.:||..:..:.|
Human   559 DEKS--------ERP-----AKRRRVNSNGKESPGSSE 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 13/74 (18%)
SANT 179..225 CDD:197842 19/73 (26%)
SANT 180..224 CDD:304392 17/47 (36%)
SANT 540..582 CDD:238096
MIER1NP_001337459.1 ELM2 272..321 CDD:307553 8/49 (16%)
SANT_MTA3_like 378..422 CDD:212559 16/43 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.