DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and mideasa

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:XP_005160646.1 Gene:mideasa / 569908 ZFINID:ZDB-GENE-041001-151 Length:1016 Species:Danio rerio


Alignment Length:255 Identity:56/255 - (21%)
Similarity:106/255 - (41%) Gaps:41/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VPGAGTPESSDDDNSTKRNGKS-----------KAKQSEYEEKIRVGRDYQAVCPPLVPEAERRP 113
            :|...||.|:  ..|..|:..|           :|.....|..|.:|..|||..|.|:..:....
Zfish   615 LPPPPTPRSA--SRSLLRSSSSDITPPAPPLIGEATPVSLEPHINIGSKYQAEIPELLDRSSALK 677

  Fly   114 EQMNERALLVWSP-TKEIPDLKLEEYISVAKEKYGYNG----EQALGMLFWHKHDLERAV----- 168
            :|  .:|.|||.| :....:.:::..:::......|.|    |.|:..|...|.|:..|:     
Zfish   678 DQ--HKATLVWQPESSASQETRVDNLMNLVCSSVMYGGGTNTELAMHCLHECKGDVMEALEMMML 740

  Fly   169 --------MDLANF-TPFPDEWTIEDKVLFEQAFQFHGKSFHRIRQMLPDKSIASLVKYYYSWKK 224
                    ..|||: ....|.|:.::|..|.:....:.|.|..:::::..|::|..|::||::||
Zfish   741 KNPIFSWNHQLANYHYAGSDYWSADEKRYFNKGISAYTKDFFMVQKLVRTKTVAQCVEFYYTYKK 805

  Fly   225 ----TRHRSSAM--DRQEKAIKAVVKDGSENGSEVGSNEE-SDNDDKKGHGTNSTINTID 277
                ||:.:...  ...|::|..:....::..::....|| .|:.|::......|:...|
Zfish   806 QARVTRNGTCTYGPSDPEESIPVMNARQADKENDCKQQEEMEDSVDERLQDVTKTLQQSD 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 13/52 (25%)
SANT 179..225 CDD:197842 13/49 (27%)
SANT 180..224 CDD:304392 10/43 (23%)
SANT 540..582 CDD:238096
mideasaXP_005160646.1 ELM2 656..707 CDD:279754 13/52 (25%)
SANT 760..805 CDD:197842 11/44 (25%)
SANT 762..805 CDD:304392 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.