DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and mier2

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:XP_021325018.1 Gene:mier2 / 564723 ZFINID:ZDB-GENE-050208-795 Length:488 Species:Danio rerio


Alignment Length:267 Identity:70/267 - (26%)
Similarity:109/267 - (40%) Gaps:46/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SSDDDNSTKRNGKSKAKQSEYEEKIRVGRDYQAVCPPLVPEA--ERRPEQMNERALLVWSPTKEI 130
            |.||..||      ....|:..:.|.||..||||.|.|..::  ||..|..::   |||:| ..:
Zfish   146 SEDDSEST------SIPSSDGRKDIMVGPQYQAVIPSLCTQSFYERAYENEDQ---LVWTP-DVM 200

  Fly   131 PDLKLEEYISVAKEKYGYNG--------------EQALGMLFWHKHDLERAVMDLA-NFTPFPDE 180
            ..|.:|:::..|:.....:|              ||||..|.....:.|.|:.... |...|.:|
Zfish   201 SSLAVEKFLLDAQRNGSDSGPTNTLTTGDKVKDNEQALYELVKCNFNAEEALRRYRFNVKVFNEE 265

  Fly   181 ---WTIEDKVLFEQAFQFHGKSFHRIR-QMLPDKSIASLVKYYYSWKKTRHRSSAMDRQEKAIKA 241
               |:.|::..||..|:.|||:|:.|: ..:..:|:...|:|||.|||:       :|.|...:.
Zfish   266 LCGWSEEERRYFEHGFRAHGKNFNLIQANKVRTRSVGECVEYYYMWKKS-------ERHEYFTQQ 323

  Fly   242 VVKDGSENGSEVGSNEESDNDDKKGHGTNSTINTIDATTTSTNNSTTNSNTTTPANIIANTINSN 306
            ..|.|.:..:....|.|....|    |....:..  ||......|:....|.:|..::  .:|..
Zfish   324 ATKLGRKKCNLPSGNIEDTEPD----GDTGDVEV--ATQGLPTRSSIQLQTPSPPTVM--ELNKQ 380

  Fly   307 HSSSNSG 313
            ....|.|
Zfish   381 ACERNIG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 19/53 (36%)
SANT 179..225 CDD:197842 18/49 (37%)
SANT 180..224 CDD:304392 17/47 (36%)
SANT 540..582 CDD:238096
mier2XP_021325018.1 ELM2 164..213 CDD:307553 18/52 (35%)
SANT_MTA3_like 269..313 CDD:212559 16/43 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.