DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and MIER2

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:NP_001374081.1 Gene:MIER2 / 54531 HGNCID:29210 Length:547 Species:Homo sapiens


Alignment Length:285 Identity:70/285 - (24%)
Similarity:118/285 - (41%) Gaps:44/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ERNTTDVVRNGRRSRGPSPNTHTTGGVTNSASLVGSGNNSGHSGNANANEKTTTAVPGAGTPESS 69
            |:...|::.........|.....|..||:..:.....|.||....|:.:.:     ||:..  ||
Human   126 EQIAKDLLSGEEEEETQSSADDLTPSVTSHEASDLFPNRSGSRFLADEDRE-----PGSSA--SS 183

  Fly    70 DDDNSTKRNGKSKAKQSEYEEKIRVGRDYQAVCPPLVPEAERRPEQM--NERALLVWSPTKEIPD 132
            |.:..:....|.|       ::|.||..:||....|  ...|..|::  ||..|| |.|: .:|:
Human   184 DTEEDSLPANKCK-------KEIMVGPQFQADLSNL--HLNRHCEKIYENEDQLL-WDPS-VLPE 237

  Fly   133 LKLEEYISVAKEKYGY--------------NGEQALGMLFWHKHDLERAVMDLA-NFTPFPD--- 179
            .::||::..|.::..:              :.||||..|.....::|.|:..|. |.....|   
Human   238 REVEEFLYRAVKRRWHEMAGPQLPEGEAVKDSEQALYELVKCNFNVEEALRRLRFNVKVIRDGLC 302

  Fly   180 EWTIEDKVLFEQAFQFHGKSFHRIR-QMLPDKSIASLVKYYYSWKKTRHRSSAMDRQEKAIKAVV 243
            .|:.|:...||..|:.|||:||.|: ..:..:|:...|:|||.|||:........:.....:..|
Human   303 AWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERYDYFAQQTRLGRRKYV 367

  Fly   244 KDGSENGSEVGSNEESDNDDKKGHG 268
            ..|:.:     ::::.|..|..|.|
Human   368 PSGTTD-----ADQDLDGSDPDGPG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 18/53 (34%)
SANT 179..225 CDD:197842 19/49 (39%)
SANT 180..224 CDD:304392 17/44 (39%)
SANT 540..582 CDD:238096
MIER2NP_001374081.1 ELM2 199..249 CDD:396160 18/53 (34%)
SANT_MTA3_like 304..348 CDD:212559 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.