DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and Mier2

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:XP_038935335.1 Gene:Mier2 / 362841 RGDID:1307278 Length:664 Species:Rattus norvegicus


Alignment Length:270 Identity:71/270 - (26%)
Similarity:110/270 - (40%) Gaps:57/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSPNTHTTGGV--TNSASLVGSGNNSGHSGNANANEKTTTAVPGAGTPESSDDDNSTKRNGKSKA 83
            ||..:|....:  ..|.|...||:|                  |.|:..|||.:.......|.| 
  Rat   267 PSVTSHEASDLFHNQSGSRFLSGDN------------------GPGSSASSDTEEDALPANKCK- 312

  Fly    84 KQSEYEEKIRVGRDYQAVCPPLVPEAERRPEQM--NERALLVWSPTKEIPDLKLEEYISVA---- 142
                  ::|.||..:||....|  ...|..:::  ||..|| |||| .:|:.::||::..|    
  Rat   313 ------KEIMVGPQFQADLNIL--HLNRHCDKIYENEDQLL-WSPT-VLPEREVEEFLYRAVKRR 367

  Fly   143 -KEKYG---------YNGEQALGMLFWHKHDLERAVMDLA-NFTPFPD---EWTIEDKVLFEQAF 193
             :|..|         .:.||||..|.....::|.|:..|. |.....|   .|:.|:...||..|
  Rat   368 WQEMAGPQIPEGEVVKDSEQALYELVKCNFNVEEALRRLRFNVKVIRDGLCAWSEEECRNFEHGF 432

  Fly   194 QFHGKSFHRIR-QMLPDKSIASLVKYYYSWKKTRHRSSAMDRQEKAIKAVVKDGSENGSEVGSNE 257
            :.|||:||.|: ..:..:|:...|:|||.|||:........:.....:..|..|:.:     :.:
  Rat   433 RVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERYDYFAQQTRLGRRKFVSSGTTD-----TEQ 492

  Fly   258 ESDNDDKKGH 267
            :.|..|..||
  Rat   493 DLDGLDPDGH 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 19/58 (33%)
SANT 179..225 CDD:197842 19/49 (39%)
SANT 180..224 CDD:304392 17/44 (39%)
SANT 540..582 CDD:238096
Mier2XP_038935335.1 ELM2 315..365 CDD:396160 19/53 (36%)
SANT_MTA3_like 420..464 CDD:212559 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.