DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and CG1620

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:NP_001260777.1 Gene:CG1620 / 35678 FlyBaseID:FBgn0033183 Length:586 Species:Drosophila melanogaster


Alignment Length:494 Identity:100/494 - (20%)
Similarity:160/494 - (32%) Gaps:189/494 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RNGRRSRGPSPNT------------HTTGGVTNSASLVGSGNNSGHSGNANANEKTTTAVPGAGT 65
            |:|..||.....|            ||:...::|.|.:     ..|.|.....|....|...|..
  Fly   136 RSGSSSRRARRATKRQYQELDTEMAHTSTSTSSSTSQL-----EKHDGIDQEEEPKEEADKLASP 195

  Fly    66 PESS-----DDDNSTKRNGKSKAKQS-------------------------------------EY 88
            |||.     |.:::.|..|..|..:|                                     |.
  Fly   196 PESGEASSVDTEDAQKYEGIKKQHRSHLLDLYPDESFVDLAPTCGEETERFTPLQTLFDEVEAEE 260

  Fly    89 EEK-----------IRVGRDYQAVCPP-LVPEAERRPEQMNERALLVWSPTKEIPDLKLEEYISV 141
            ||:           |.||.||||..|. |....:..|.:..::  |:|.|: ::.:.::|||::.
  Fly   261 EEESESELDDARKIIMVGHDYQAEIPEGLSQYGDILPYENEDQ--LIWEPS-QVSEREVEEYLAK 322

  Fly   142 AKE-------------KYGYNG---------------------------------------EQAL 154
            .:|             ..|..|                                       ||||
  Fly   323 IQETRSIVPPDDGSETTAGEEGAATGATIEPPAPITAPATPPRAPLATSGAGDQELVVKDNEQAL 387

  Fly   155 GML----FWHKHDLERAVMDLANFTPFPDEWTIEDKVLFEQAFQFHGKSFHRIRQ-MLPDKSIAS 214
            .:|    :..|..|.|..|::...|.....|:.::.:.||:..|..||.|::||| .:..:::..
  Fly   388 HLLVQCGYDFKEALRRKRMNVLPLTDTMSSWSEDECLKFEEGIQRFGKDFYQIRQNQVRTRTMRE 452

  Fly   215 LVKYYYSWKKTRHRSSAMDRQEKAIKAVVKDGSENGSEVGSNEESDNDDKKGHGTNSTINTIDA- 278
            ||.:||.|||:..|..:.                                   ..|.||:.:|. 
  Fly   453 LVHFYYLWKKSERRDQSF-----------------------------------ALNDTIDHMDVF 482

  Fly   279 -TTTSTNNSTTNSNTTTPANIIANTINSNHS----SSNSGGGGNINNNGEENIQA---------- 328
             ......|.:.|.|   .|.|::.|.|||.|    |||....|:::...::.|.:          
  Fly   483 INEAGGGNGSGNGN---GAGIVSGTANSNGSCSPHSSNGHSNGDLSALEKDTIASPRKPASKSYS 544

  Fly   329 -VGGSNTISNTSNND---MDAEQLSLFAGNAQIEEMMAL 363
             :.||..:.|.|..:   ..:..|.|...:..:||..:|
  Fly   545 IMTGSQAVGNPSGGNRKRCSSASLPLEDEDNNVEEEPSL 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 16/52 (31%)
SANT 179..225 CDD:197842 16/46 (35%)
SANT 180..224 CDD:304392 15/44 (34%)
SANT 540..582 CDD:238096
CG1620NP_001260777.1 ELM2 275..320 CDD:279754 15/47 (32%)
SANT 417..463 CDD:197842 16/45 (36%)
SANT_MTA3_like 417..462 CDD:212559 15/44 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.