DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and Mier1

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:XP_017448862.1 Gene:Mier1 / 313418 RGDID:1562337 Length:698 Species:Rattus norvegicus


Alignment Length:422 Identity:95/422 - (22%)
Similarity:149/422 - (35%) Gaps:106/422 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NNSGHSGNANANEKTTTAVPGAGTPESSDDDNSTK------------RNGKSKAKQSEYEE---- 90
            :|||.||. |..|....:.......:||:||.|..            |..|.....||.||    
  Rat   291 DNSGCSGE-NKEENIKDSSGQEDETQSSNDDPSQSVTSQDAQEIIRPRRCKYFDTNSEIEEESEE 354

  Fly    91 ------------KIRVGRDYQAVCPPLVPEAERRPEQMNERALLVWSPTKEIPDLKLEEYISVAK 143
                        :|.||..:||..|..|...:...:.......|:|.| :.:|:.|:..::..|.
  Rat   355 DEDYIPSEDWKKEIMVGSMFQAEIPVGVCRYKENEKVYENDDQLLWDP-EYLPEDKVIVFLKDAS 418

  Fly   144 EKYG--------------YNGEQALGMLFWHKHDLERAVMDLA-NFTPFPDE---WTIEDKVLFE 190
            .:.|              .:.||||..|.....|.|.|:..|. |.....:|   ||.|:...||
  Rat   419 RRTGDEKGVEAIPEGSHIKDNEQALYELVKCSFDTEEALRRLRFNVKAAREELSVWTEEECRNFE 483

  Fly   191 QAFQFHGKSFHRIR-QMLPDKSIASLVKYYYSWKKTRH-----RSSAMDRQEKAIKAVVKDG--- 246
            |..:.:||.||.|: ..:..:|:...|.:||.|||:..     :.:...:::..:...|.|.   
  Rat   484 QGLKAYGKDFHLIQANKVRTRSVGECVAFYYMWKKSERYDFFAQQTRFGKKKYNLHPGVTDYMDR 548

  Fly   247 --SENGSEVGSNEESDNDDKKGHGTNSTINTIDATTTSTNNSTTNSNTTTPANIIANTINSNHSS 309
              .|:.|...|...|                  ...|::|:||:.|....     ....|||.:.
  Rat   549 LLDESESAASSRAPS------------------PPPTASNSSTSQSEKED-----GTLSNSNQNG 590

  Fly   310 SNSGGGGNINNNGEENIQAV------GGSN--TISNTSNNDMDAEQLSLFAGNAQIEEMMALGLA 366
            .:|.|.|.|.|..|..::.:      ||:.  .:::...|..:...|   |.:.::..|.|    
  Rat   591 VSSNGPGEILNKEEVKVEGLHVNGPTGGNKKPLLTDVDTNGYEENNL---ATDPKLAHMTA---- 648

  Fly   367 ADRAIGANGGNNNNNGEMGGDPGLMRRMVVGG 398
                     .|.|:..|....|...||:...|
  Rat   649 ---------RNENDFDEKNERPAKRRRINSSG 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 13/51 (25%)
SANT 179..225 CDD:197842 18/49 (37%)
SANT 180..224 CDD:304392 17/47 (36%)
SANT 540..582 CDD:238096
Mier1XP_017448862.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.