DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and Y105C5A.1

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:NP_001370076.1 Gene:Y105C5A.1 / 178439 WormBaseID:WBGene00013632 Length:767 Species:Caenorhabditis elegans


Alignment Length:205 Identity:46/205 - (22%)
Similarity:82/205 - (40%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGHSGNANANEKTTTAVPGAGTPESSDDDNSTKRNGKSKAKQSEYEEKIRVGRDYQAVCPPLVPE 108
            :|||.......|...::    .|.:||.|.|..:|.:.         |||.|..:||..|.:.| 
 Worm   293 AGHSSKDLIKRKARNSL----EPSTSDADISFMKNERG---------KIRTGEKFQATIPDIEP- 343

  Fly   109 AERRPEQMN--ERALLVWSPTKEIPDLKLEEYISVAKEKYGYNGEQALGMLFWHKHDLERAV-MD 170
            :....|.|:  ::..:.|. |.::....|||     .:|:    .:.|..::|      ||: ..
 Worm   344 SSTLTEYMDQEDKEEIFWE-TLDMDKDNLEE-----SKKF----HETLRNVYW------RAIWRQ 392

  Fly   171 LANFTPFPD--EWTIEDKVLFEQAFQFHGKSFHRIRQMLPDKSIASLVKYY---YSWKKTRHRSS 230
            .....||..  :..:::.:.|.|:.:...::...:.|...:..:|. ||.:   ...|||..|  
 Worm   393 FQGHIPFETALQHLMKNNLDFAQSLETIDENLKSLPQSFKEPCVAQ-VKIFDKLLQDKKTTRR-- 454

  Fly   231 AMDRQEKAIK 240
              ..||||::
 Worm   455 --QLQEKAMR 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 14/53 (26%)
SANT 179..225 CDD:197842 7/50 (14%)
SANT 180..224 CDD:304392 6/46 (13%)
SANT 540..582 CDD:238096
Y105C5A.1NP_001370076.1 PRK14950 <104..242 CDD:237864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.