Sequence 1: | NP_001188671.1 | Gene: | CoRest / 32941 | FlyBaseID: | FBgn0261573 | Length: | 824 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001370076.1 | Gene: | Y105C5A.1 / 178439 | WormBaseID: | WBGene00013632 | Length: | 767 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 46/205 - (22%) |
---|---|---|---|
Similarity: | 82/205 - (40%) | Gaps: | 43/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 SGHSGNANANEKTTTAVPGAGTPESSDDDNSTKRNGKSKAKQSEYEEKIRVGRDYQAVCPPLVPE 108
Fly 109 AERRPEQMN--ERALLVWSPTKEIPDLKLEEYISVAKEKYGYNGEQALGMLFWHKHDLERAV-MD 170
Fly 171 LANFTPFPD--EWTIEDKVLFEQAFQFHGKSFHRIRQMLPDKSIASLVKYY---YSWKKTRHRSS 230
Fly 231 AMDRQEKAIK 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CoRest | NP_001188671.1 | ELM2 | 92..144 | CDD:279754 | 14/53 (26%) |
SANT | 179..225 | CDD:197842 | 7/50 (14%) | ||
SANT | 180..224 | CDD:304392 | 6/46 (13%) | ||
SANT | 540..582 | CDD:238096 | |||
Y105C5A.1 | NP_001370076.1 | PRK14950 | <104..242 | CDD:237864 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160160600 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |