DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and T07F8.4

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:NP_495478.1 Gene:T07F8.4 / 174173 WormBaseID:WBGene00020320 Length:345 Species:Caenorhabditis elegans


Alignment Length:297 Identity:69/297 - (23%)
Similarity:105/297 - (35%) Gaps:83/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSPNTHTTGGVTNSASLVGSGNNSGHSGNANANEKTTTAVPGAGTPESSDDDNSTKRNGKSKAKQ 85
            |:.|:......|..|.     .|.|.|.:|.|....:|......:....|||:..........|:
 Worm    67 PAENSSANNEDTEIAE-----ENVGESSSAAAEPHDSTIFDMGNSMSGFDDDDDDYAPPPDPWKR 126

  Fly    86 SEYEEKIRVGRDYQAVCPPLVPEAERRPEQMNERALLVWS------PTKEIPDLKLEEYISVAKE 144
            |     |||.........||..||... |...|...::|:      |:.|:.|..|::.:.:.|.
 Worm   127 S-----IRVDPVLFQADVPLFNEATVE-ESAREDDTILWTIDQTNQPSDEVIDNYLKDVVGLRKA 185

  Fly   145 ---------KYGYNGEQALGMLFWHKHDLERAVMDLANFTPFP----------------DEWTIE 184
                     ....:.|.||..|:....|.|:|....    |||                ||   .
 Worm   186 HDQPCPPAGTESRDDEDALCALYRSNFDTEKAKESF----PFPHINAPFRTVRSDALGFDE---S 243

  Fly   185 DKVLFEQAFQFHGKSFHRIRQM-LPDKSIASLVKYYYSWKKT------------------RHRSS 230
            :...||::.:.:||.|..||:: ||.:.:..|::|||.||.|                  .|.|:
 Worm   244 EAKAFEESLELYGKDFSLIRRLRLPYRKVGELIEYYYQWKLTPGYRVWRDAHPQHAPVVQPHLSA 308

  Fly   231 AMDRQEKAIKAVVKDGSENG---------SEVGSNEE 258
            |..:|      |.:...:||         ||..::||
 Worm   309 AWHQQ------VAQLEDQNGQTGFVEASFSEPSTSEE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 14/57 (25%)
SANT 179..225 CDD:197842 17/46 (37%)
SANT 180..224 CDD:304392 15/44 (34%)
SANT 540..582 CDD:238096
T07F8.4NP_495478.1 ELM2 128..179 CDD:366648 14/51 (27%)
SANT_MTA3_like 240..283 CDD:212559 15/45 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.