DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and MIER3

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:XP_011541518.1 Gene:MIER3 / 166968 HGNCID:26678 Length:566 Species:Homo sapiens


Alignment Length:505 Identity:101/505 - (20%)
Similarity:174/505 - (34%) Gaps:141/505 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TTDVVRNGRRSRGPSPNTHTTGGVTNSASLVGSGNNSGHSGNANANEKTTTAVPGAGTPESSDD- 71
            |...|.|...:..||........:|.....:.....||......::....|  |...:.|:||. 
Human    94 TIPAVANSSANSSPSELADELPDMTLDKEEIAKDLLSGDDEETQSSADDLT--PSVTSHETSDFF 156

  Fly    72 ----DNSTKRNGKSKAKQSEYEE--------------KIRVGRDYQAVCPPLVPEAERRPEQMNE 118
                .::|..:|.   |:||.|:              :|.:|..|||..||.:.|.:...:....
Human   157 PRPLRSNTACDGD---KESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEKVYEN 218

  Fly   119 RALLVWSPTKEIPDLKLEEY-----ISVAKEK---------YGYNGEQALGMLFWHKHDLERAVM 169
            ...|:|.| ..:.:.|::||     :....||         :..:.||||..|....|:::.|:.
Human   219 EDQLLWCP-DVVLESKVKEYLVETSLRTGSEKIMDRISAGTHTRDNEQALYELLKCNHNIKEAIE 282

  Fly   170 DLANFTPFPDE----WTIEDKVLFEQAFQFHGKSFHRI-RQMLPDKSIASLVKYYYSWKKT---- 225
            ..........|    ||.|:...||.|....||.||.| :..:..:::|..|.:||.|||:    
Human   283 RYCCNGKASQEGMTAWTEEECRSFEHALMLFGKDFHLIQKNKVRTRTVAECVAFYYMWKKSERYD 347

  Fly   226 -------------RHRSSAMDRQEKAI-KAVVKDGSENGSEVGSNEESDNDDKKGHGTNSTINTI 276
                         .|.....|..::.: :.....|:.|.|.:.||......|::       :|.:
Human   348 YFAQQTRFGKKRYNHHPGVTDYMDRLVDETEALGGTVNASALTSNRPEPIPDQQ-------LNIL 405

  Fly   277 DATTTSTNNSTTNSNTTT--PANIIANTINSNHSSSNSGGGGNIN-------------NNGEE-- 324
            ::.|.|...:.|||..|.  |.::  |.::.:.....:...|.:|             :|||.  
Human   406 NSFTASDLTALTNSVATVCDPTDV--NCLDDSFPPLGNTPRGQVNHVPVVTEELLTLPSNGESDC 468

  Fly   325 -NIQAVGGSNTISNTSN-----NDMDAEQLSL-------FAGNAQIEEM---------------M 361
             |:...|..::..|..|     ::..|::|.:       |.....:..:               |
Human   469 FNLFETGFYHSELNPMNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKM 533

  Fly   362 ALGLAADRAIGANGGNNNNNGEMGGDPGLMRRMVVGGFCKICNVVCHVLH 411
            |:.:|...::.||..|                    ||     :..|.||
Human   534 AVSVADFGSLSANETN--------------------GF-----ISAHALH 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 14/56 (25%)
SANT 179..225 CDD:197842 18/50 (36%)
SANT 180..224 CDD:304392 17/48 (35%)
SANT 540..582 CDD:238096
MIER3XP_011541518.1 ELM2 192..240 CDD:396160 14/48 (29%)
SANT_MTA3_like 298..342 CDD:212559 16/43 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.