DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CoRest and LOC100535969

DIOPT Version :9

Sequence 1:NP_001188671.1 Gene:CoRest / 32941 FlyBaseID:FBgn0261573 Length:824 Species:Drosophila melanogaster
Sequence 2:XP_009291072.1 Gene:LOC100535969 / 100535969 -ID:- Length:975 Species:Danio rerio


Alignment Length:356 Identity:92/356 - (25%)
Similarity:142/356 - (39%) Gaps:72/356 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NGRRSRGP---SPNTHTTGGVTNSASLV----------GSGNNSGHSGNANANEKTTTAVPGAGT 65
            :|:.|||.   .....|...:::.|...          |||..|..||.||........:..|| 
Zfish   529 DGQESRGAVLFRSQLRTASSMSDDAPYTPPPMLSPARPGSGLFSAVSGRANIQSTPERLLSRAG- 592

  Fly    66 PESSDDDNSTKRNGKSKAKQSEYEEKIRVGRDYQAVCPPLVPEAERRPEQMNERALLVWSPTK-- 128
              ..||...|     .|........:|.:|.::||..|.:  :.:...|:.:..|:|:||.||  
Zfish   593 --EMDDCGET-----LKETAINVTPRINIGEEFQAKIPNI--KGQSLTEEDSHNAVLLWSQTKDM 648

  Fly   129 EIPD--LKLEEYISVAKEKY----GYNGEQALGMLFWHKHDLERAVMDL---------ANF-TPF 177
            |.||  .|::..:.:|....    |.|.|..|..||..:.|:...|..|         :|. |.:
Zfish   649 ESPDNQHKVDNLLKMACSSVLPGGGANTEYVLHCLFECRGDIMNTVEKLLLPTLIRHTSNLKTDY 713

  Fly   178 ----PDEWTIEDKVLFEQAFQFHGKSFHRIRQMLPDKSIASLVKYYYSWKKTRHRSSAMDRQEKA 238
                .|.||:::|....:|...|.|.|:.:::|:..||:|..|:|||:|||   |.....|...|
Zfish   714 HYAGSDRWTLQEKRQLNKALLLHHKDFYLVQKMVKTKSVAQCVEYYYTWKK---RLRLCSRVSTA 775

  Fly   239 IKAVVKD-----GSENGSEVGSNEESDNDDKKGHGTNSTINTIDATTTSTNNSTTNSNT-----T 293
            :...|:|     .:.|.||......|.:.|.:    ||:...:   ...||..|...|.     :
Zfish   776 LATPVQDVRGDWATNNHSEPKKESISKSRDSE----NSSAAFV---CEQTNEETWTQNNLRLLCS 833

  Fly   294 TPA----NIIANTINS---NHSSSNSGGGGN 317
            :||    :.:..|:.|   ..|.|||...|:
Zfish   834 SPAEHRPSALTETLGSASVRSSPSNSTTSGD 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoRestNP_001188671.1 ELM2 92..144 CDD:279754 17/55 (31%)
SANT 179..225 CDD:197842 18/45 (40%)
SANT 180..224 CDD:304392 16/43 (37%)
SANT 540..582 CDD:238096
LOC100535969XP_009291072.1 zf-C2H2_6 400..421 CDD:290623
ELM2 612..666 CDD:279754 17/55 (31%)
SANT 719..765 CDD:197842 19/48 (40%)
SANT 721..764 CDD:304392 16/42 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.