DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3a and ICDH

DIOPT Version :9

Sequence 1:NP_001259705.1 Gene:Idh3a / 32940 FlyBaseID:FBgn0027291 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_175836.1 Gene:ICDH / 841875 AraportID:AT1G54340 Length:416 Species:Arabidopsis thaliana


Alignment Length:376 Identity:86/376 - (22%)
Similarity:139/376 - (36%) Gaps:92/376 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KVTLIPGDGIGPEISAAVQKIFTAANVPIEWEAVDVTPVRGPDGKFGIPQAAIDSVNTNKIGLKG 113
            |||:        |.:.|..|.    ||.|  :...:||               |.....:.|||.
plant    57 KVTI--------ETAEATLKY----NVAI--KCATITP---------------DEARVREFGLKK 92

  Fly   114 PLMTPVGKGHRSLNLALRKEFNLYANV--------RP-CRSLEGYKTLYDDVDVVTIRENTEG-- 167
            ...:|.|.....||..:.:|..:..|:        :| |.....:...|...|::.   |..|  
plant    93 MWRSPNGTIRNILNGTVFREPIICRNIPRLVPGWTKPICIGRHAFGDQYRATDLIV---NEPGKL 154

  Fly   168 ----EYSG----IEHEIVD---GVVQSIKLITEEASKRVAEYAFQYAKNNNRKKVTVVHKANIMR 221
                |.||    .|.|:.:   |.|......|:|:.:..|| :..|.....:..:.:..|..|::
plant   155 KLVFEPSGSSQKTEFEVFNFTGGGVALAMYNTDESIRAFAE-SSMYTAYQKKWPLYLSTKNTILK 218

  Fly   222 MSDGLFLRCVRDMAQKFPEIQFEEKY-----------LDTVCLNMVQNPGKYDVLVMPNLYGDIL 275
            :.||.|    :|:.|:..|..:..||           :|.:....:::.|.| |....|..||:.
plant   219 IYDGRF----KDIFQEVYEANWRSKYEAAGIWYEHRLIDDMVAYAMKSEGGY-VWACKNYDGDVQ 278

  Fly   276 SDMCAGLVGGLGLTPSGNMGLNGALF--ESVHGTAP------DIAGKDLANPTALLLSAVMMLRH 332
            ||..|...|.||:..|..:..:|...  |:.|||..      ...|:...|..|.:.:....|.|
plant   279 SDFLAQGYGSLGMMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAH 343

  Fly   333 -------MELNTYADKIERAAFETIKEGKYLTGDL-----GGRAKCSEFTN 371
                   ..|.:|.:|:|.|...|::.|| :|.||     |.:.:..::.|
plant   344 RAKLDSNAALLSYTEKLEAACMGTVESGK-MTKDLALLIHGAKVRRDQYVN 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3aNP_001259705.1 Iso_dh 46..377 CDD:294303 86/376 (23%)
ICDHNP_175836.1 PLN00103 1..409 CDD:177720 86/376 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.