DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3a and IDH-IV

DIOPT Version :9

Sequence 1:NP_001259705.1 Gene:Idh3a / 32940 FlyBaseID:FBgn0027291 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_174526.2 Gene:IDH-IV / 840142 AraportID:AT1G32480 Length:214 Species:Arabidopsis thaliana


Alignment Length:227 Identity:80/227 - (35%)
Similarity:136/227 - (59%) Gaps:18/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KKVTLIPGDGIGPEISAAVQKIFTAANVPIEWEAVDVTPVRGPDGKFGIPQAAIDSVNTNKIGLK 112
            :.||:|..:     ::.||.::..|...|:.:|..   .::|.:... :....:||:..||:.|.
plant     3 RPVTVIDSN-----VTNAVHQVMDAMQAPVYFETY---IIKGKNMNH-LTWEVVDSIRKNKVCLN 58

  Fly   113 GPLMTPVGKGHRSLNLALRKEFNLYANVRPCRSLEGYKTLYDDVDVVTIRENTEGEYSGIEHEIV 177
                   |:.:.||....|||.:|:|::..|.:|.|..:.:::||:|.|||||||||:|.|||:|
plant    59 -------GRVNNSLCGGARKELDLFASLVDCFNLNGQPSRHENVDIVVIRENTEGEYAGREHEVV 116

  Fly   178 DGVVQSIKL-ITEEASKRVAEYAFQYAKNNNRKKVTVVH-KANIMRMSDGLFLRCVRDMAQKFPE 240
            .||::|.:: :|:..|.|:|:|||:||..:.|||||.|| .....:::|..||...:::|:.:|.
plant   117 PGVIESFQVTMTKFWSDRIAKYAFEYAHFSKRKKVTAVHNNGKYEKLADAFFLESCQEVAKMYPN 181

  Fly   241 IQFEEKYLDTVCLNMVQNPGKYDVLVMPNLYG 272
            |.:.|..::..||.:|:.|.::||:|.|||||
plant   182 ITYNEIGINNCCLQLVEKPERFDVIVTPNLYG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3aNP_001259705.1 Iso_dh 46..377 CDD:294303 80/227 (35%)
IDH-IVNP_174526.2 Iso_dh 2..>213 CDD:294303 78/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.