DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3a and Idh3b

DIOPT Version :9

Sequence 1:NP_001259705.1 Gene:Idh3a / 32940 FlyBaseID:FBgn0027291 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_570954.1 Gene:Idh3b / 170718 MGIID:2158650 Length:384 Species:Mus musculus


Alignment Length:376 Identity:155/376 - (41%)
Similarity:241/376 - (64%) Gaps:23/376 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIAARDAPA----VTATPAVSQVNATPAASRSYS-----SGTKKVTLIPGDGIGPEISAAVQKIF 70
            ::|||::.|    .|:|        ..|||:|.:     .|...||::||||:|||:..||:::|
Mouse    14 VLAARNSGAWRGLGTST--------AHAASQSQAQDVRVEGAFPVTMLPGDGVGPELMHAVKEVF 70

  Fly    71 TAANVPIEWEAVDVTPVRGPDGKFGIPQAAIDSVNTNKIGLKGPLMTPVG-KGH-RSLNLALRKE 133
            .||.||:|::...::.|:....:..:.| .:.|:..||:.:.|.:.||:. ||. .|.::.||::
Mouse    71 KAAAVPVEFKEHHLSEVQNMASEEKLEQ-VLSSMKENKVAIIGKIYTPMEYKGELASYDMQLRRK 134

  Fly   134 FNLYANVRPCRSLEGYKTLYDDVDVVTIRENTEGEYSGIEHEIVDGVVQSIKLITEEASKRVAEY 198
            .:|:|||...:||.||||.::::|:|.|||.||||||.:|||...||::.:|::|...|:|:|::
Mouse   135 LDLFANVVHVKSLPGYKTRHNNLDLVIIREQTEGEYSSLEHESAKGVIECLKIVTRTKSQRIAKF 199

  Fly   199 AFQYAKNNNRKKVTVVHKANIMRMSDGLFLRCVRDMAQKFPEIQFEEKYLDTVCLNMVQNPGKYD 263
            ||.||....|.|||.|||||||::.|||||:|..::|:.:|:|:||...:|..|:.:||||.::|
Mouse   200 AFDYATKKGRSKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFD 264

  Fly   264 VLVMPNLYGDILSDMCAGLVGGLGLTPSGNMGLNGALFE--SVHGTAPDIAGKDLANPTALLLSA 326
            |||||||||:|:.::.||||||.|:.|..:.....|:||  :.|..|..: |:::|||||:||||
Mouse   265 VLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAV-GRNIANPTAMLLSA 328

  Fly   327 VMMLRHMELNTYADKIERAAFETIKEGKYLTGDLGGRAKCSEFTNEICAKL 377
            ..||||:.|..::..|..|..:.||.||..|.|:||.:..::|...:...|
Mouse   329 TNMLRHLNLEYHSSMIADAVKKVIKAGKVRTRDMGGYSTTTDFIKSVIGHL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3aNP_001259705.1 Iso_dh 46..377 CDD:294303 144/334 (43%)
Idh3bNP_570954.1 Iso_dh 46..379 CDD:351095 144/334 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.