DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSD17B2 and CG8888

DIOPT Version :9

Sequence 1:NP_002144.1 Gene:HSD17B2 / 3294 HGNCID:5211 Length:387 Species:Homo sapiens
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:383 Identity:103/383 - (26%)
Similarity:172/383 - (44%) Gaps:50/383 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    21 GTVFCKYKKSSGQLWS--------WMVCLAG-------LCAVCLLILSPF----WGLILFSVSCF 66
            |::....:||....|.        ::.|.|.       |.|:.:..:|.|    | ..|.:|...
  Fly    20 GSISALPQKSHEIPWDIFERLFMPFLFCQAAAIVTSHLLHALDISSISTFAVFVW-FALATVGAV 83

Human    67 LMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLN--ENGPGAEELRRTCS 129
            |.|.::.    :....|.||:||.:..|...|.|.||:|||||:||...  |....|:.|:...|
  Fly    84 LFYHFVK----VSASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKILKEVTS 144

Human   130 PRLSVLQMDITKPVQIKDAYSKVAAMLQD--RGLWAVINNAGVLGFPTDGEL--LLMTDYKQCMA 190
            .|:.:|.:|:|....|.:|...|:..|..  .|||:|::.|..:..   |||  :.....::.:.
  Fly   145 GRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIAL---GELEWIPFAVLRKSLD 206

Human   191 VNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGI 255
            :|..|:..:|:.||||:|::.||:|.::|.....|........:::|||..|::.:|.|:...|:
  Fly   207 LNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGV 271

Human   256 KVASIQPGGFLTNIAGTSDKW------EKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLA 314
            .|:.:..|.|     ...:.|      ....|.:.:.|.:|.::.||:||..|....:...:..|
  Fly   272 DVSVVAAGEF-----APGNGWLNETELRDQAKQMWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQA 331

Human   315 SKDFSPVLRDIQHAILAKSPFAYYTP-GKGAYLWICLAHYLPIGIYDYFAKRHFGQDK 371
            : |..|.||.:..|:....|.|.||| .....|.|.||.:|...:|:..    :|:.|
  Fly   332 A-DIQPTLRVLIDAVTRTFPMARYTPVTSSERLQIFLAEHLAPSLYESL----YGEQK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSD17B2NP_002144.1 type2_17beta_HSD-like_SDR_c 83..362 CDD:187665 86/291 (30%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 86/296 (29%)
adh_short 96..293 CDD:278532 61/204 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm41558
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.