DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfrx and TFC7

DIOPT Version :9

Sequence 1:NP_477451.1 Gene:Pfrx / 32938 FlyBaseID:FBgn0027621 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_014753.1 Gene:TFC7 / 854277 SGDID:S000005636 Length:435 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:42/175 - (24%)
Similarity:73/175 - (41%) Gaps:40/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 TIYLTRHG-------ESEY--NLSGLIGGDSNLSARGHQYANALSTFIAQQQIDGLRVWTSWMKR 522
            |||:.|||       |..|  .|:| |..|..|:..|.|.|..|:.::..........:.|...|
Yeast     5 TIYIARHGYRSNWLPEGPYPDPLTG-IDSDVPLAEHGVQQAKELAHYLLSLDNQPEAAFASPFYR 68

  Fly   523 AIQTVADVKAPQE----------RW-----KALNEIDAGHCEEMTYEQIKEKFPEEFKARDVNKF 572
            .::||..:....|          .|     |.:..:.||      ||.:.:.||... :::.:..
Yeast    69 CLETVQPIAKLLEIPVYLERGIGEWYRPDRKPVIPVPAG------YEILSKFFPGVI-SQEWDST 126

  Fly   573 AYRYPRGESYEDLVARLE---PVIME-LERQ-GNV---LVVSHQA 609
            .....:||:.:::..|.:   |:.:| :|:: .||   |:|:|.|
Yeast   127 LTPNEKGETEQEMYMRFKKFWPLFIERVEKEYPNVECILLVTHAA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfrxNP_477451.1 6PF2K 254..465 CDD:279872
AAA_33 256..412 CDD:290396
His_Phos_1 468..651 CDD:278716 41/174 (24%)
TFC7NP_014753.1 PhoE 5..186 CDD:223483 42/175 (24%)
TFIIIC_sub6 289..>368 CDD:402169
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.