DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfrx and PFK27

DIOPT Version :9

Sequence 1:NP_477451.1 Gene:Pfrx / 32938 FlyBaseID:FBgn0027621 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_014505.1 Gene:PFK27 / 853984 SGDID:S000005496 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:324 Identity:89/324 - (27%)
Similarity:135/324 - (41%) Gaps:72/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 YNTSPSLRVRTTSLNQLKKTADLAIENELHVC----------PSVMSEELRKLLPPTSETVMTKP 239
            ||:|.||    .|||.....:..:::.....|          .|::|.|:.:.:   |...:..|
Yeast    18 YNSSNSL----FSLNTGNSYSSASLDRATLDCQDSVFFDNHKSSLLSTEVPRFI---SNDPLHLP 75

  Fly   240 FPIRGERTIADCT------TPHVIAMVGLPARGKTFISKKLARYL--NWIGISTR--VFNLGEYR 294
            ..:..:|..||.|      ...:|.::||||.||:.||..|.:.|  |.:..|.|  |||.|:.|
Yeast    76 ITLNYKRDNADPTYTNGKVNKFMIVLIGLPATGKSTISSHLIQCLKNNPLTNSLRCKVFNAGKIR 140

  Fly   295 RHATTA----------YKSHEFFRADNEEAMAIRNRCANQAL-----HDSCDWLLSGQGSIAVFD 344
            |..:.|          ..|.:.|...|.:......|...|.|     :|.||        :.:||
Yeast   141 RQISCATISKPLLLSNTSSEDLFNPKNNDKKETYARITLQKLFHEINNDECD--------VGIFD 197

  Fly   345 ATNSTRDRRQLIHDIVV-----KQHGFRL--FFVESICDDPQIIEQNILEVKVSSPDYLNMNTEL 402
            |||||.:||:.|.:.|.     :...|.|  ..::..|.:...|:.|| ..|..:.|||:...||
Yeast   198 ATNSTIERRRFIFEEVCSFNTDELSSFNLVPIILQVSCFNRSFIKYNI-HNKSFNEDYLDKPYEL 261

  Fly   403 VVRDFLQRIEHYEERYQP--IDEVTESH------------LSFMKVYNAGKKVVVYNNEGHVES 452
            .::||.:|::||..::.|  :||..:.|            |.|..|.|||.......|:.|..|
Yeast   262 AIKDFAKRLKHYYSQFTPFSLDEFNQIHRYISQHEEIDTSLFFFNVINAGVVEPHSLNQSHYPS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfrxNP_477451.1 6PF2K 254..465 CDD:279872 71/239 (30%)
AAA_33 256..412 CDD:290396 56/181 (31%)
His_Phos_1 468..651 CDD:278716
PFK27NP_014505.1 6PF2K 84..324 CDD:396253 73/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344141
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000312
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10606
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.