DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfrx and AT3G60450

DIOPT Version :10

Sequence 1:NP_477451.1 Gene:Pfrx / 32938 FlyBaseID:FBgn0027621 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001326035.1 Gene:AT3G60450 / 825216 AraportID:AT3G60450 Length:306 Species:Arabidopsis thaliana


Alignment Length:250 Identity:51/250 - (20%)
Similarity:81/250 - (32%) Gaps:55/250 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IGVVRLTYFLTKQASVESNKITSSAIQTSTVSTFSGISTKSHTSPTPRLLSTSSTLASG-NRTCT 141
            ||.:..|||.|..:......:..|.:.......|.       |..||.|.:..:...|| .....
plant    16 IGGIFSTYFSTMYSVSPLQPVPDSVMPNQDGDKFL-------TFVTPELTTELTEQPSGWASELP 73

  Fly   142 DGFTHINNKCWKLVTGPKSRADADKTCYDLGGSTLFSIRNDQENQALMEFVKDQKVENLWAGL-- 204
            |.::......|......|::.||         ||:.:.:.:.:.|.|.:..|:. :..::.||  
plant    74 DMWSQQQVMDWISYNVEKNKWDA---------STMDTSQCEMDGQRLCQLSKED-MTRIFGGLGD 128

  Fly   205 -----ICD-RHGPAWCTWDLQSGTTAVYNNF---ADGWPSNEDKICNYFMTNGTQAGKWASASCT 260
                 :|. |..|..|    .|.....:..|   .|  ||:.|.||::......|.|        
plant   129 KLYGHLCQLREWPGSC----DSSLGEYFFKFHLTKD--PSDWDLICDFIKNEDNQHG-------- 179

  Fly   261 ETMSFVCELPATIYDNTCEYNYDNYCYTPYFELKLSSEAQTFCASSGSNLVSIHS 315
                    :...|.|:.......:|.|.|    ...|.|.:....||....|.|:
plant   180 --------IKREIDDDDFSMKMTDYGYYP----DPISPASSGSCGSGMEAYSPHT 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfrxNP_477451.1 6PF2K 254..465 CDD:396253 11/61 (18%)
His_Phos_1 468..651 CDD:459751
AT3G60450NP_001326035.1 His_Phos_1 47..>234 CDD:459751 44/218 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.