DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfrx and AT3G60440

DIOPT Version :10

Sequence 1:NP_477451.1 Gene:Pfrx / 32938 FlyBaseID:FBgn0027621 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_191603.2 Gene:AT3G60440 / 825215 AraportID:AT3G60440 Length:291 Species:Arabidopsis thaliana


Alignment Length:151 Identity:35/151 - (23%)
Similarity:61/151 - (40%) Gaps:52/151 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 RVWTSWMKRAIQTVADVKAPQERWKALNEID----AGHCEEMT-YEQIKEKFPEEFKARD-VNKF 572
            ||:.|...|.|||.::|.|      ||:.:|    |...:::| .::.|.|...||...: :|..
plant    91 RVFVSPFIRCIQTASEVIA------ALSAVDFDPNATSSKDVTSIDKYKLKVSIEFGLSEMLNSI 149

  Fly   573 AYR---YPRGESYEDLVARLE-------------PVIMELER-----QG---------------- 600
            |.:   .|:...::.:::.||             ||..|:.:     :|                
plant   150 AIKPEIAPKDGKFDFMISELEAIFPDGMVDHSVDPVYKEMPQWEETVEGCTDRFLSLIKTLADKY 214

  Fly   601 ---NVLVVSHQAVLRCLFAYF 618
               |:|:|:|...:|..||.|
plant   215 PSENLLLVTHGEGVRTTFATF 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfrxNP_477451.1 6PF2K 254..465 CDD:396253
His_Phos_1 468..651 CDD:459751 35/151 (23%)
AT3G60440NP_191603.2 PhoE 38..254 CDD:440175 35/151 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.