DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfrx and ubash3bb

DIOPT Version :9

Sequence 1:NP_477451.1 Gene:Pfrx / 32938 FlyBaseID:FBgn0027621 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001122227.1 Gene:ubash3bb / 569827 ZFINID:ZDB-GENE-080724-6 Length:642 Species:Danio rerio


Alignment Length:368 Identity:74/368 - (20%)
Similarity:123/368 - (33%) Gaps:119/368 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SSSSSASSTSSSSTSATAAGTALASAAASAVAKKLARSVT-----ATSIMDMPYNTSPS------ 190
            ||:....|||......|:.||.::.............|.|     :.|.    :.||||      
Zfish   272 SSTLEQMSTSEGWVYGTSLGTGISGLLPENYVSPADESDTWVFHGSHSF----FCTSPSEKGCKE 332

  Fly   191 -------LRVRTTSLNQLKKTADLAIENELHVCP--SVMSEELRKLLPPTSETV------MTKPF 240
                   |.:|....::|.::|.|::     :|.  .|:...::...|..:..|      |...|
Zfish   333 TKALDGLLNIRCFENSRLGESAILSV-----ICQPMQVLRSNIQSRAPKRTLFVCRHGERMDVVF 392

  Fly   241 PIRGERTIADCTTP-------HVIAMVGLPARGKTFISKKLARYLNWIGISTRVFNLGEYRRHAT 298
               |:..::.|:..       ::.....|||||.|....::...:..:| ||:...:||....:.
Zfish   393 ---GKHWLSQCSDSKGRYVRRNLNMPAALPARGATHRDYEMDAPITVVG-STQAKIVGEALLESN 453

  Fly   299 TA----YKSHEFFRADNEEAMAIRNRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRRQLIHDI 359
            |:    |.|...             ||.                               |..|:|
Zfish   454 TSIDFVYCSPSL-------------RCV-------------------------------QTAHEI 474

  Fly   360 V--VKQHGFRLFFVESICDDPQIIEQNILEVKVSSPDYL--------NMNTELVVRDF-----LQ 409
            :  ::|.| ||    ||..:|.:.|........|.|.::        |:|.:...|..     |.
Zfish   475 LRGMQQEG-RL----SIRVEPGLFEWTKWVSGTSLPAWIPPTDLAAANLNVDTTYRPHMPISKLT 534

  Fly   410 RIEHYEERYQPIDEVTESHLSFMKVYNAGKKVVVYNNEGHVES 452
            ..|.||......::||:..|::.|  |.||.::..   ||..|
Zfish   535 VSEAYETYISRSNQVTKDILAYCK--NKGKNILFV---GHASS 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfrxNP_477451.1 6PF2K 254..465 CDD:279872 46/225 (20%)
AAA_33 256..412 CDD:290396 33/174 (19%)
His_Phos_1 468..651 CDD:278716
ubash3bbNP_001122227.1 UBA_UBS3B 28..65 CDD:270486
SH3_UBASH3B 245..306 CDD:212869 8/33 (24%)
HP_PGM_like 378..613 CDD:132718 51/253 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.