DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfrx and UBASH3A

DIOPT Version :9

Sequence 1:NP_477451.1 Gene:Pfrx / 32938 FlyBaseID:FBgn0027621 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_061834.1 Gene:UBASH3A / 53347 HGNCID:12462 Length:661 Species:Homo sapiens


Alignment Length:401 Identity:78/401 - (19%)
Similarity:131/401 - (32%) Gaps:127/401 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 HATTAYKSHEFFRADNEE-AMAIRNRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRRQLIHDI 359
            |.|.|:|.:...:...|: |.||       .|..||.|      :.|::     :||.|      
Human   234 HLTLAHKFYPHHQRTLEQLARAI-------PLGHSCQW------TAALY-----SRDMR------ 274

  Fly   360 VVKQHGFRLFFVESICDDPQIIEQNILEVKVSSPDY----------------LNMNTELVVRDFL 408
            .|.....|..|        |...||:.|:.:|..||                :.::.....|.||
Human   275 FVHYQTLRALF--------QYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFL 331

  Fly   409 QRIEHYEERYQPIDEVTESHL---SFMKVYNAGKKVVVYNNEGHVESRI-------------VYY 457
            .  |:|.:|....|...:..:   |.....|:.|       :|...||.             ...
Human   332 P--ENYTDRASESDTWVKHRMYTFSLATDLNSRK-------DGEASSRCSGEFLPQTARSLSSLQ 387

  Fly   458 LMNIHITPRTIYLTRHGESEYNLSGLIGGDSNLSARGHQYANAL--------------------- 501
            .:...:..:::.:.||||....:.|........:..|..|...|                     
Human   388 ALQATVARKSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPP 452

  Fly   502 --STFIAQQQI-------DGLRVWTSWMKRAIQTVADVKAPQERWKALNEI-------------- 543
              |..|.|.:|       .|:|:.:.:...|::.|...|...|..|...:|              
Human   453 LSSCGIFQSRIAGDALLDSGIRISSVFASPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKW 517

  Fly   544 DAGHCEE--MTYEQIKE-KFPEEFKARDVNKFAYRYPRGESYEDLVARLEPVIMEL-----ERQG 600
            :||....  |:.|::|| .|..:...|.....:...| .|||::.:.|....::::     :..|
Human   518 EAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMP-AESYQEYMDRCTASMVQIVNTCPQDTG 581

  Fly   601 NVLVVSHQAVL 611
            .:|:|||.:.|
Human   582 VILIVSHGSTL 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfrxNP_477451.1 6PF2K 254..465 CDD:279872 39/201 (19%)
AAA_33 256..412 CDD:290396 29/132 (22%)
His_Phos_1 468..651 CDD:278716 39/196 (20%)
UBASH3ANP_061834.1 UBA_UBS3A_like 25..61 CDD:270485
SH3_UBASH3A 279..338 CDD:212870 14/68 (21%)
HP 370..>502 CDD:299704 20/131 (15%)
Phosphatase-like 395..661 39/199 (20%)
His_Phos_1 450..612 CDD:278716 31/144 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.