DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfrx and pfkfb4

DIOPT Version :9

Sequence 1:NP_477451.1 Gene:Pfrx / 32938 FlyBaseID:FBgn0027621 Length:716 Species:Drosophila melanogaster
Sequence 2:XP_031755833.1 Gene:pfkfb4 / 407880 XenbaseID:XB-GENE-1001570 Length:490 Species:Xenopus tropicalis


Alignment Length:443 Identity:251/443 - (56%)
Similarity:318/443 - (71%) Gaps:4/443 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 LRKLLPPTSETVMTKPFPIRGERTIADCTTPHVIAMVGLPARGKTFISKKLARYLNWIGISTRVF 288
            |:|:..|.:.   ..|.....:|.:.....|.:|.||||||||||:|||||.|||||||:.|:.|
 Frog    13 LKKIWVPYNN---GHPVQHSAQRKVCMTNCPTLIVMVGLPARGKTYISKKLTRYLNWIGVPTKEF 74

  Fly   289 NLGEYRRHATTAYKSHEFFRADNEEAMAIRNRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRR 353
            |:|:|||.....:||.|||..||||....|.:||..||:|...:|....|.:|||||||:||:||
 Frog    75 NVGQYRRDLVKTFKSFEFFLPDNEEGQKTRKQCALLALNDVRRYLGEEGGHVAVFDATNTTRERR 139

  Fly   354 QLIHDIVVKQHGFRLFFVESICDDPQIIEQNILEVKVSSPDYLNMNTELVVRDFLQRIEHYEERY 418
            :.|... ..|:||:.|||||:|.||::|.|||::||:.|||||:.::|....||::||:.|:..|
 Frog   140 ETILKF-ADQNGFKTFFVESVCVDPEVIAQNIVQVKLGSPDYLHCSSEEATEDFMKRIDCYKNSY 203

  Fly   419 QPIDEVTESHLSFMKVYNAGKKVVVYNNEGHVESRIVYYLMNIHITPRTIYLTRHGESEYNLSGL 483
            :.:||..:..||::|:.:.|.:.:|.....|::|||||||||||||||:|||.||||||.|:.|.
 Frog   204 ETLDENFDRDLSYIKIMDVGCRYLVNRVMDHIQSRIVYYLMNIHITPRSIYLCRHGESELNIKGR 268

  Fly   484 IGGDSNLSARGHQYANALSTFIAQQQIDGLRVWTSWMKRAIQTVADVKAPQERWKALNEIDAGHC 548
            |||||.||.||.::|..|..:|.:|.|..|:||||.|||.|||...:..|.|:||.|||||||.|
 Frog   269 IGGDSGLSRRGKEFAQCLGKYIHEQNIHDLKVWTSQMKRTIQTAEALSVPYEQWKTLNEIDAGVC 333

  Fly   549 EEMTYEQIKEKFPEEFKARDVNKFAYRYPRGESYEDLVARLEPVIMELERQGNVLVVSHQAVLRC 613
            |||.||:|:|.||.||..||.:|:.||||:||||||||.||||||||||||.||||:.||||:||
 Frog   334 EEMRYEEIQESFPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRC 398

  Fly   614 LFAYFLDKSADELPYLYVPLHTVIKLTPVAYGCKVEHIKLPIDAVDTHRPKPK 666
            |.|||||||..|||||..|||||:||||||||||||.:.|.::||:|||.||:
 Frog   399 LLAYFLDKSGGELPYLKCPLHTVMKLTPVAYGCKVECVCLNVEAVNTHRNKPE 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfrxNP_477451.1 6PF2K 254..465 CDD:279872 109/210 (52%)
AAA_33 256..412 CDD:290396 85/155 (55%)
His_Phos_1 468..651 CDD:278716 126/182 (69%)
pfkfb4XP_031755833.1 6PF2K 36..250 CDD:396253 109/214 (51%)
His_Phos_1 253..436 CDD:395236 126/182 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 275 1.000 Domainoid score I1721
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 544 1.000 Inparanoid score I1139
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D232517at33208
OrthoFinder 1 1.000 - - FOG0000312
OrthoInspector 1 1.000 - - otm48632
Panther 1 1.100 - - O PTHR10606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X325
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.