DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfrx and F55A11.11

DIOPT Version :9

Sequence 1:NP_477451.1 Gene:Pfrx / 32938 FlyBaseID:FBgn0027621 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001370163.1 Gene:F55A11.11 / 3565838 WormBaseID:WBGene00010082 Length:314 Species:Caenorhabditis elegans


Alignment Length:323 Identity:59/323 - (18%)
Similarity:109/323 - (33%) Gaps:103/323 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 SLNQLKKTADLAIENELHVCPSVMSEELRKLLPPTSETVMTKPFPIRGERTIADCTTPHVIAMVG 261
            ||::.:|:.||..|||      ..:..||     :..||..|...|..:.|:...:...|..:.|
 Worm     2 SLSKNRKSLDLDDENE------SSAHYLR-----SQWTVCVKSAKILKKVTVVMRSAERVDRVFG 55

  Fly   262 LP-ARGKTFISKKLARYLN----------WIGISTRVFNLGEYRRHATTAYKSHEFFRADNEEAM 315
            .. .:.:.:::|..|..:|          :...:..:.|:|:|.....               ..
 Worm    56 SAWLKSEKYMTKVNATDINVPKGAVLHPHFYHFNPPITNIGKYSAQLI---------------GR 105

  Fly   316 AIRNRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRRQLIHDIVVKQHGFRLFFVESICDDPQI 380
            |:|||.....:......|.:.|.:.|                  :.|..|.|:           :
 Worm   106 ALRNRGIEPGVIFCSPTLRTLQTAAA------------------IAKSTGARI-----------L 141

  Fly   381 IEQNILEV--------KVSSPDYLNMNTELVVRDFLQRIEHYEERYQPIDEVTESHLSFMKVYNA 437
            :|..:||.        ....||:.:     ...||.|    .::.|:||..:.|    |..::.|
 Worm   142 VEPGLLEPMEWYRRAGAKQLPDFFD-----EALDFPQ----VDKTYKPIFSMHE----FTSMFGA 193

  Fly   438 GKKVVVYNNEGHVESRIVYYLMNIHI----TPRTIYLTRHGES-EYNLSGLIGGDSNLSARGH 495
                   .::.....||:..:.||.:    ||..|.    |.: ..:::..||...::.:.||
 Worm   194 -------KSQEQCIQRIMLVVKNICVIFRDTPALII----GHAVTMDVASKIGQHGDMLSSGH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfrxNP_477451.1 6PF2K 254..465 CDD:279872 36/233 (15%)
AAA_33 256..412 CDD:290396 26/174 (15%)
His_Phos_1 468..651 CDD:278716 6/29 (21%)
F55A11.11NP_001370163.1 HP 87..>231 CDD:416258 35/211 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.