DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfrx and Ubash3a

DIOPT Version :9

Sequence 1:NP_477451.1 Gene:Pfrx / 32938 FlyBaseID:FBgn0027621 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_808491.2 Gene:Ubash3a / 328795 MGIID:1926074 Length:624 Species:Mus musculus


Alignment Length:397 Identity:92/397 - (23%)
Similarity:140/397 - (35%) Gaps:118/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 HATTAYKSHEFFRADNEE-AMAIRNRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRRQLIHDI 359
            |.|.|:|.:...:...|: |.||      |..| ||.|      :.|::     :||.| .:|..
Mouse   196 HLTLAHKFYPHHQRTLEQLAKAI------QPSH-SCQW------TAALY-----SRDMR-FVHYQ 241

  Fly   360 VVKQHGFRLFFVESICDDPQIIEQNILEVKVSSPDY----------------LNMNTELVVRDFL 408
            .:|    .||         |...||..|:.:|:.||                :.::.....|.||
Mouse   242 TLK----ALF---------QYKPQNADELMLSAGDYIFVDPTQQEEASEGWAIGISHRTGCRGFL 293

  Fly   409 QRIEHYEERYQPIDEVTESH---------LSFMKVYNAGKKVVVYNNEGHVE--SRIVYYLMNIH 462
            .  |:|.||....|...:..         |:..|.:.|..:   .|.|.|..  |:.|..:..:.
Mouse   294 P--ENYTERANEADTWVKHRTYTFNLAMDLNSRKDFEASCR---GNGEPHTPSMSKSVSSIQALQ 353

  Fly   463 --ITPRTIYLTRHGESEYNLSGLIGGDSNLSARGHQY-------------ANALSTF-------- 504
              |:.|.|.:.||||....:.|........:|.|..|             :|.:..|        
Mouse   354 ATISRRGILVVRHGERVDQVFGKSWLQQCTTADGKYYRPDLNFPRSLPRRSNGIKDFENDPPLSS 418

  Fly   505 --IAQQQI-------DGLR---VWTSWMKRAIQTVADVKAPQERWKALN-EIDAGHCEEMTYEQI 556
              |.|.::       .|:|   |:.|...|.:||...:....:..|.|. .::.|..|.|.:|..
Mouse   419 CGIFQARLAGEALLDSGVRVTAVFASPALRCVQTAKHILEELKLEKKLKIRVEPGIFEWMKWEAS 483

  Fly   557 KEKFP----EEFKARDVN-KFAYR--YPR-----GESYEDLVARLEPVIMEL-----ERQGNVLV 604
            |....    ||.|..:.| ...||  .||     .|||:..|.|....:.::     :..|..|:
Mouse   484 KATLTFLTLEELKEANFNVDLDYRPALPRCSLMPAESYDQYVERCAVSMGQIINTCPQDMGITLI 548

  Fly   605 VSHQAVL 611
            |||.:.|
Mouse   549 VSHSSAL 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfrxNP_477451.1 6PF2K 254..465 CDD:279872 45/198 (23%)
AAA_33 256..412 CDD:290396 31/132 (23%)
His_Phos_1 468..651 CDD:278716 46/195 (24%)
Ubash3aNP_808491.2 UBA_UBS3A_like 25..61 CDD:270485
SH3_UBASH3A 241..300 CDD:212870 15/73 (21%)
Phosphatase-like 358..624 47/198 (24%)
HP 361..>456 CDD:132716 20/94 (21%)
His_Phos_1 413..575 CDD:278716 35/143 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.